SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017234 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017234
Domain Number 1 Region: 231-554
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-89
Family Protein kinases, catalytic subunit 0.0000000764
Further Details:      
 
Domain Number 2 Region: 5-79
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.71e-19
Family PB1 domain 0.00022
Further Details:      
 
Domain Number 3 Region: 90-157
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017234   Gene: ENSGACG00000013018   Transcript: ENSGACT00000017268
Sequence length 574
Comment pep:known_by_projection group:BROADS1:groupXII:17555097:17619093:-1 gene:ENSGACG00000013018 transcript:ENSGACT00000017268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMLIADLAATVTFVELREEVRRMCSVAKQLPVTLKWIDDEGDPCTISSQMELEEAFRIYS
RTRRSGLQLHVFPSIPERPGMPCPGEDQSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYC
GHCAERIWGLAGQGYKCINCKLLVHKRCHRLIPQTCQRLMDPVMPSQEPPSDARSEEVDL
PPEDAEDTDGIPFLPHNCTVDQTQDADTEDIKAVVDGIDGIKLSQGLALGLGDFDLIRVI
GRGSYAKVLLVRLKKNKQVYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHS
SFQTESRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRDLK
LDNVLLDHDGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALG
VLMFEMMAGRSPFDIITDNPDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLNKDPK
ERLGCQVQTGFIDIKAHTFFRNIDWEQLEKKEMTPPFKPQITDDYGLENFDTQFTNEPVQ
LTPDDADVIKKIDQSEFEGFEYINPLLLSTEESV
Download sequence
Identical sequences G3PI07
ENSGACP00000017234 69293.ENSGACP00000017234 ENSGACP00000017234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]