SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017270 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017270
Domain Number 1 Region: 610-802
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-62
Family Sec7 domain 0.00000737
Further Details:      
 
Domain Number 2 Region: 812-952
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000246
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017270   Gene: ENSGACG00000013060   Transcript: ENSGACT00000017304
Sequence length 1142
Comment pep:novel group:BROADS1:groupXIX:16737219:16757413:1 gene:ENSGACG00000013060 transcript:ENSGACT00000017304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSLLENPVQAILYLRELTTIVQNQQSLIQTQRSRIEELDRRVDELIGENRHLRDVRAT
SEVQQPSQPMDPGDMQLVPADLSTVSPVDSEPENGGSSQSCRTLVPMTPTALCHSLALSR
KSDPSPPASHQSTSARHLMPVKGGAQRARERTRPDSKRFCLLSSPLCLPTPPSLSRLPFR
SETVLHQFCCPAPEHPEADTTGSSSNQGKQRGALVETCIAATNLTKQHLTHKHSHLCPEP
TQPHITLCRYRCSHEPPRKNGLADDPDCRDGRILKEVEGTKREGPSEYEISLENKNKQID
ELEQKYGGHLIARRAARRIQTAFRQYQLSKNFQKIRNSLSESKLPRRISMRHPSPSGRNR
NTAQRHSYSLHPGGVQIPLRSKTPPPTPGQTLTQLEDCFSDQLHSLALSIDDALRGWSLS
EGGDGKGLLMDPGALRAAAESACLPRSASSLLMAFRDVTVHIDSNSSSLGNAGGGQPGSR
KTSASGVDGGGDGEFAEEPEFPAPPPSEELEMADAGSRRGSAVATLGGGGGTEGVIGTDR
LGSTSTSISTSAQSNQQPAQIYTQYQQYHYTHPQQIPGGPSPDALQALVVSLPRDHCQDP
ASCRSPTLSTDTHRKRLYRIGLNLFNVNPERGIHFLITRGFVPDTAIGVAHFLLQRKGLS
RQMIGEFLGNSKLQFNRDVLDCVVDEMDFSGMELDEALRKFQAHVRVQGEAQKVERLIEA
FSQRYCMCNPDVVQQFHNPDTIFILAFAVVLLNTDMYSPNIKPQRKMGLDDFIRNLRGVD
DGADIPREMVAGIYERIQQRELRSNEDHVTYVSRVEQSIMGLKTILAVPHRRLVCCCRLF
EVPDANKPHKQKLSQLQREVFLFNDLLLILKLCPKKKSSASYTFCKAMGLLGMQFHLFSN
EYYAHGITMLSPFTSEKKQLVSFCSPSGEELRKFAEELREAITEVNEMEQIHIQWELERQ
QGILPHGIHTNGGQVDTHTGHGSPSVKGQQDAYDKTGNNTVEVSIHNRLQTYQLSQPSIE
STPLALAAPPALLGSIPPGDLRPDTLIQCQQIVKVIVVDQSGRGRMEAFLSQGPAAHQLI
HSAMSTPVRVIDGGDGPQPPLPPPPPPYNHPHQFCPPDSPMPFHHTLPLTRRRNSSGSRS
IV
Download sequence
Identical sequences G3PI43
ENSGACP00000017270 69293.ENSGACP00000017270 ENSGACP00000017270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]