SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017301 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017301
Domain Number 1 Region: 502-770
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.66e-109
Family N-acetyl transferase, NAT 0.000000000433
Further Details:      
 
Domain Number 2 Region: 255-325
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.32e-17
Family PHD domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017301
Domain Number - Region: 204-270
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000168
Family PHD domain 0.024
Further Details:      
 
Domain Number - Region: 96-173
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000305
Family Linker histone H1/H5 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017301   Gene: ENSGACG00000013076   Transcript: ENSGACT00000017335
Sequence length 2149
Comment pep:known_by_projection group:BROADS1:groupXIII:15952079:15970721:1 gene:ENSGACG00000013076 transcript:ENSGACT00000017335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKPAHPMYTQWILEAIKKVKKQKQRPSEERCNAVSMSHSLDRKTILEQLELSVKDGTIL
KVTNKGLNSYKDPENPGRFALPKSKGSSSSSHSGKRPGLDWNKLLKRALEGLHEPGGSSL
KNIERFLKCQADVAGYLSSSGSLGSGLFHQHLRVALKRAVAHGRVAKQGPLFQLISRSSC
LDDGTGTVSLGSLPPVRLLPHEKDRPVAEPIPICSFCLGTKEQNRDKRPEELISCADCGN
SGHPSCLKFSPELTARVKALWWQCIECKTCSSCQDQGKNADNMLFCDSCDRGFHMECCDP
PLTRMPKGMWICQICQPRKKGKRLLHEKAAQIKRRYNAPLGRPKNRPGRPFKKLGRRGRR
KRSASANSSSSSSCEGYPGDDRLLFSMRDDGDLSQDSLRFNNKTKGLIDALTKFFTPSPE
GRKARQEVVDYSQQCRIRKKASRKGEGDDRDNQEGSDWRDEDEKLPGHENLTEKDIELFR
HIQELALQKVGVTGPPDPQMRCPSVIEFGKFEIQTWYSSPYPQEYSRLPKLYLCEFCLRY
MKSRSILYQHMKKCNWFHPPANEIYRKEDVSVYEVDGNVSTIYCQNLCLLAKLFLDHKTL
YYDVEPFLFYVLTQNDNKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRRGYGRFLIDFS
YLLSKREGQPGSPEKPLSDLGRLSYMAYWRSVVLECLHDVRDRQITIRQLSKLTGICPQD
ITTSLHSLNMLDQRGERLVLVRREKLVSNHMTRLKARPRQLDVDPECLRWAPVIVTNTVV
SDGDDDEEEEDDEPEEHIRKEIKPSHKVPAMSWHQQRKCFLGFPMNQSSPASTPIRCPPP
APEPPRPPPPTNGERRPRGRPPKNWPWGKVKDSARVGRPPKIRPAGDEDDKGNRRTEGGK
TIGSATGPPSLFSMDRRAESTTFHSLDMGRHPSIVPSRRGRPPRKKRGPNPRLMDGAGVG
LAQLPMVSRLTESLPIRKSCFSESSEEEEEEDDDDEDDDERRAGSPPVLTKPALGLKCKK
PLRKRHFRQRSHPHSSVVTETISETTEVLDEPFVDSDSERPMPRLEEETPLGHPLHRYPP
ARSAMRLSDPAPKRTRHSNLTDSEEDERTPLLKPVAAPPAAPSGTQADNLEVPVKKKKGW
PKGKSRKPLHWKKRGPGRPPGSRAAADRRAQGGDPPPPKIKMKPGRKPRGWHEQRAREEA
ERQRLAGQQVDKGLQPLQTDDRSSKRVCRTTTDRDAKPKDSEEDDDYRPKPVEQKLPKRP
RGRPPKNRALRPPPQPAPKPPPASEAVKAWKEDKPGRPPPRALLSPSSLSGPRPPQSRPQ
ETDMGNREEDDDDEEREEEECGRVVSGGGTVNRRASVPPGSGSRRSEDHDADDEGDGHLE
SKKRKGQDSEEDDDDDDEDEEEEEPTSRASSPPVKEEPQVGEAFLDMENSVTRDVTTTTQ
EAKCRPPSADPRQEERRRREQEESAAAAAAVETVTGPSEPMELQSLHPDDKDVTLLMEPQ
HPHPHSHPSQHPDFKEELGHHHPHHSHHHSNELDLETMQAVQSLTQGEAQDEEAEPQPHH
GAYQDCEETLAACRTLQSYSHAGEAEDEALALVEECGASQHSSPLPNPTVPPLPSQSVRS
VNSPGLPSGIMDTTAAGQRGGTPGPTGAAGSGGGTGGGYTQITPEHPSSLSAPSQQNMET
SPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYDNPSSYDSTMGGGGGTGNRGGDHAGA
TTASSSSSSSATPSSSQSNSCSFVPAPSLTSSAGMGSCSLIQQTGPNSGPGASNVGSAVA
QPPPPPPPSNTPGCGIKSPQSCVVIERPPSTNLQQQQSQKKVSQQQQAPNPPQSEALSQC
SMGNGFASTPMIMEIPESGGGGRHMYDRMGPDFGTGGYPQPSATFSLAKLQQLTNTIMEP
HAMPYSPSASVASYATSVSLSNPGLAPSPHTSLAQGQPTMTPPNLSSGSMNLGSLQLQCN
MPTANIGLGPPPHTKRLQGQMATVQSHIAIRSKATQQLAPAPHQQQLYGRSSGAVSMQGT
SRTLAVQRGMMPNLMPTPASYNSMNMAPLNAMSAGYRMPQPMMNSGYHGNPPYMNQPAQY
PMQMQMGMMGGQGYPQQAMQPNHHGNMMYTGPSHHSYTGVPKQSPYMSR
Download sequence
Identical sequences G3PI74
ENSGACP00000017301 ENSGACP00000017301 69293.ENSGACP00000017301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]