SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017317 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017317
Domain Number 1 Region: 1222-1365
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-54
Family Phosphotyrosine-binding domain (PTB) 0.00000209
Further Details:      
 
Domain Number 2 Region: 6-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.22e-31
Family Dual specificity phosphatase-like 0.00012
Further Details:      
 
Domain Number 3 Region: 174-301
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.37e-24
Family PLC-like (P variant) 0.055
Further Details:      
 
Domain Number 4 Region: 1081-1216
Classification Level Classification E-value
Superfamily SH2 domain 1.32e-22
Family SH2 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017317   Gene: ENSGACG00000013093   Transcript: ENSGACT00000017351
Sequence length 1370
Comment pep:known_by_projection group:BROADS1:groupIII:613967:632308:-1 gene:ENSGACG00000013093 transcript:ENSGACT00000017351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGYELDLTYITERIIAVSFPRGCTEEIYSHNLKDVTRMLKSKHADNYLIINLSEKRHD
LTKMNPKTLDTGWPDMHAPPLDKICTICKAMESWLNADPLHVAVIHCRGGKGRIGVVISS
FVHFTDVSASADQALDRFAMRKYYDDKVSALMTPSQKRYVWILNSLLSGSMKINASPLFL
HCVILHGIPNFDATGVCRPYIKVYQGMQTVYSSGIYHIGPAHRGRVCITLEPAQLLKGDI
MFKGYHKSAVPSERKVVFRVHSHREAGQGYTLMFEKRARRPPTKDPRFADYGKVELVFSE
GPEKIPDPGAVRWQNGADVIVDYNTADPLIRWDSYQNICDGEAPPSLGLTRDAAANKRSP
GGGEAPLGRGARTASATSSPDHSDHALSVSSDSGLSSTSLWADPNTTSNTVRPNQGPSQQ
EKVQLKRLLSGFGLEEPPAGEMEDQVPRLVLQQIAPARVHLNGEPRPRERETDILDDEVI
AGHDLQSVDSLGTLSSSCHKSSQNSLLSDGFGSPGGEEQHHPQQHHLQHHPAPPLAEDYE
RAYAEARRGCLGSRSNSVATANPASAAAKQHVYRQGSYSTQSWVRQQQMVAAQQFLYTPD
DGNDAEGYPGSKPASASAKAGLHAEPQEGQATAAVERDEEFKSLTMDIDNSIDQLNQLIM
DLDPTFLPVSSGSGSLKRSGANGSLTNGIDLRFRDNNAATALKNTQQTAVFRAGDGRVGA
ARTLSCQRSDAPDQAGFCSSAWAGAEEYSDRRTYAQQPWLYRTDSAEYRAQGSEMDSGVE
AGSDVTPPTPAFPISPPTPYVKSMSELTPLMQTPSAGTPFFGGYRTDHGGCKSECAVGVH
RGHSSSWLKWSLFITERPTCFPFQSTVTSRGLVSTLEAERCPQKPEDIQRRSVTLYQTAT
GHLVPQTRATSGQTGTGSSASQSWPEHPVLSRHSSLSSRQPPQHSMSLDYGHHSPPPHHP
HVHPAPNGHSSPRGCAARHALSRSPARSFDEQDGSALGYGADAPLTFDGRMQPPHTQAPL
LPEKKRASGGEHSLGTASPAPSGFSSPHSGSSLSIPFPSVLPDLSAQTPGTASPLPDVLA
IKQLTVKFVQDTSKFWYKPEISRDQAILVLKDKEPGCFIVRDSHSFRGAYGLAMKVATPP
PSVLQQTKKGGDLANELVRHFLIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPC
KLIIPDGDPLEDVVENTSQLITNSAAELLKQGAACNVWYLGSMEMESLTGVQAVQKAASM
SLSSNPPPTSTVVHFKVSSQGITLTDNQRKLFFRRHYNVNTVIFCALDPQERKWKRDGCP
SAKIFGFVARKTGTSTDNVCHLFAEHDPEQPASAIVNFVSKVMIGSQKNK
Download sequence
Identical sequences G3PI90
ENSGACP00000017317 ENSGACP00000017317 69293.ENSGACP00000017317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]