SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017355 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017355
Domain Number 1 Region: 38-350
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-74
Family Ras GEF 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017355   Gene: ENSGACG00000013112   Transcript: ENSGACT00000017389
Sequence length 361
Comment pep:known_by_projection group:BROADS1:groupXX:15486177:15493397:-1 gene:ENSGACG00000013112 transcript:ENSGACT00000017389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTTWYCPLELSTVVEEQDDGVIYTVVVKQQHGAPTSPASVSRSQCVKAGTEEKLVLHLL
HSFSMGDSSFITIFLSTYRSFTSTGRVLDILTDRLENPPGGNEGSRMRQSFNRAVCTVFS
TWLSEYPEDFKSLEEPSRLLRLVPLLPQDSSSAADLSARILRIAEALSEKALLPDARKDH
TGPTGPPPDASKFEPTSVLGFPAALIAEQLTRLETELFVRLVPYHCLGSLWSQRDKKGRE
GVCWSVRATIRQFNKLANAVLASCLWPTGLRSQQRARLLEKWISVAEECRARKNFSSLYA
IVSALQSNPIHRLRKTWQDTDREAVRRYEELSEIFSDKDNYSQSRELLKEEGTAKFANLD
S
Download sequence
Identical sequences G3PIC8
ENSGACP00000017355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]