SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017361 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017361
Domain Number 1 Region: 142-220
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000106
Family PHD domain 0.012
Further Details:      
 
Domain Number 2 Region: 57-117
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000104
Family PHD domain 0.016
Further Details:      
 
Domain Number 3 Region: 1-49
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000012
Family Tudor domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017361   Gene: ENSGACG00000013128   Transcript: ENSGACT00000017395
Sequence length 313
Comment pep:known_by_projection group:BROADS1:groupXX:15507829:15514904:1 gene:ENSGACG00000013128 transcript:ENSGACT00000017395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGDDVLARWSDGLLYLGNVKRVVDGVKQSCLVRFEDNSEFWVLRKDIHSCASVAAGVEEV
CCICDAPPLKEPLVNCLKCRHGYHAECHTPAIEPEADSDSWICRQCVFAVATKRGGALKR
GRFARLMQFMKLRLPYQLSSLDWDPQHLTNQQQCYCYCAGPGEWNLKMLQCGSCGQWFHE
ACTQCLTKPLLYGDRFYQFQCSVCTKGPETIQRLPMTWMDLAHLVLYHLSLCCKRKYFDF
DHEILSFTNENWDSLLLGALSDTPRQDRCHNLLNALNSHKDRFVSGKEIKKKKCLFGLQV
RAPPPLTSDSSPL
Download sequence
Identical sequences G3PID4
ENSGACP00000017361 69293.ENSGACP00000017361 ENSGACP00000017361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]