SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017367 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017367
Domain Number 1 Region: 160-262
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000285
Family Synaptotagmin-like (S variant) 0.079
Further Details:      
 
Domain Number 2 Region: 109-163
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000142
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017367   Gene: ENSGACG00000013133   Transcript: ENSGACT00000017401
Sequence length 274
Comment pep:known_by_projection group:BROADS1:groupXX:15588254:15597118:1 gene:ENSGACG00000013133 transcript:ENSGACT00000017401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLPGDPSHYRPAQTIPSSLPPPVRALSFLSRRLKGSIKRAKSQPKLDRTSSFRHMILPRF
RSADQDRTRLMQSFKESHSHESLLSPSSAAEALDLTLDEDAIIKPVHSSILGQEYCFEVT
TASGTKCFACRSAAERDKWIENLQRAVKPNKDNSRRVDNVLKLWIIEARELPAKKRYYCE
LCLDDMLYARTTSKPRTDTVFWGEHFEFNNLPAVRNLRLHLYKETDKKRRKEKSTYLGLV
SIPISSITGRQFVEQWYPVIQPSVLTKGAGGGGG
Download sequence
Identical sequences G3PID9
ENSGACP00000017367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]