SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017369 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017369
Domain Number 1 Region: 382-524
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-37
Family Third domain of FERM 0.0000141
Further Details:      
 
Domain Number 2 Region: 277-383
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-30
Family Second domain of FERM 0.0000116
Further Details:      
 
Domain Number 3 Region: 192-272
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-21
Family First domain of FERM 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017369   Gene: ENSGACG00000013124   Transcript: ENSGACT00000017403
Sequence length 652
Comment pep:known_by_projection group:BROADS1:groupXVIII:15163258:15191530:-1 gene:ENSGACG00000013124 transcript:ENSGACT00000017403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVTMTTEAGSETEVKEKAEEPATQPDQSEKAADEAQEVASGEGQEKGKEGKGIGRYLPTW
LKKQKSQSQTSPTKEAPPTEDAVGEVTQKEEEPAPDVNGHDRCSASAESERFHPVITLRY
SGPPGDISASVTRPKETPAVTESTSDWKEEKEKMRQTAKAEETADKVQEETQPSQTSIFQ
SPLRLVRKTKMKLMECHVSLLDGTDFTCEVEKRAKGQFLFFKVCEHLNLMEKDYFGLFYM
DNHAQTCWLDPTKDIKRQIRIIFYCVFSFSLKILPSDPSLLTEDITRYLLCLQLREDVAS
GRLPCSFVTHALLGSYTLQAEFGDHEPDQPRTLGLGQLTFAPNQNKDMEEKILELHKSLS
FRGMTPAQADAQFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCANGLLVYKDRLRINRFA
WPKILKISYKRNNFYIKIRPGETEQFESTVGFKLQNHRCAKRLWKVCVENHSFFSIVLNK
DPTKARFLTLGSKFRYSGRTQAQTRTASSLIDRPAPNFQRTSSKRISRSLDGGGEGGMER
GLRATEGGLAGWSSCFGPSPAEAAAVADKNSIADTKEPAKSPCVCCVCVRTTLKGGLSET
RIEKRIVITGDCDIDHDQALAQAIKEAKEQHPDMSVTRVVVHKETELAEEED
Download sequence
Identical sequences G3PIE1
ENSGACP00000017369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]