SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017373 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017373
Domain Number 1 Region: 276-580
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-89
Family p120GAP domain-like 0.0000451
Further Details:      
 
Domain Number 2 Region: 139-278
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000342
Family Synaptotagmin-like (S variant) 0.074
Further Details:      
 
Domain Number 3 Region: 88-140
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000126
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017373   Gene: ENSGACG00000013133   Transcript: ENSGACT00000017407
Sequence length 1155
Comment pep:known_by_projection group:BROADS1:groupXX:15588346:15602871:1 gene:ENSGACG00000013133 transcript:ENSGACT00000017407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHPLQSFLSRRLKGSIKRAKSQPKLDRTSSFRHMILPRFRSADQDRTRLMQSFKESHSHE
SLLSPSSAAEALDLTLDEDAIIKPVHSSILGQEYCFEVTTASGTKCFACRSAAERDKWIE
NLQRAVKPNKDNSRRVDNVLKLWIIEARELPAKKRYYCELCLDDMLYARTTSKPRTDTVF
WGEHFEFNNLPAVRNLRLHLYKETDKKRRKKEKSTYLGLVSIPISSITGRQFVEQWYPVI
QPSVLTKGAGGGGGKIINASLRLKSRFQTMNILPMELYKEFAEYVTNNYRTLCAVLEPVL
SVKSKEEVACALVHILQSTGKAKDFLSDMAMCEVDRFMDREHLIFRENTLATKAIEEYLK
LIGHKYLKDAIGEFIRALYESEENCEVDPMRTPPSVLPDHQANLRMCCELALCKIVNSHC
VFPRELKEVFASWRVRCAERGREDIADRLISGSLFLRFLCPAIMSPSLFNLTQEYPDEQT
SRTLTLIAKVVQNLANFSKFGNKEDYMCFMNEFLEMEWGSMQQFLYEISNLDSVSNAGGF
EGYIDLGRELSILHSLLWEVIAQLSKDAIIKLGPLPRLLNDISMALRNPHLQRQPSHQTD
RVQERQADRLLSRPSFNRGISSEFQNLMMRDLNSLPSSAFVRPYSPLSSSSIDITRLPSP
TSTGPRPPPASSKDMFYVSRPPLARSSPAYCTSSSDITEPDPKLLSVNKSVSMMDLRDSR
MNSVSNLQSVDMLNSSQASIAGMGSQLRAGGRLSAGSGGSSMSGGLRLSQLSQMGNTTDS
LSQQQQQQAAAMRYPLSFQNPLFHLATADGPQQQQLHHQHSRAQPPAPLLLTPEPDPSHP
TYMPQFAHGGFSRSEDLSTLRTRDGHLGQPSIIHSHSYSDDYSRAEYGRRQTSMNMQTGT
SHSSLAATPPSTVLPVRQSSVAPPPPRVKSQTSHQLSVSAAAAPAALAKTRPPSANLLQS
PESGYGGRQHGARQLSVKDNTAPGLPHQQSSARESQSPQGTTGQSAQQSPQQQAQQHLLK
PSMSKQGSQTPSTLNPPTPANERTVAWVSNMPHLSADIESSRIDREEFKLKEYSKSMDES
RMDRVKEYEEEINSLKDRLVMSHKKLEEYERRLLTQEQQTNKILLQYQNRLDDSERKLRQ
QQVEKDSQIKGIISR
Download sequence
Identical sequences G3PIE5
ENSGACP00000017373 69293.ENSGACP00000017373 ENSGACP00000017373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]