SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017376 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017376
Domain Number 1 Region: 390-526
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-37
Family Third domain of FERM 0.0000141
Further Details:      
 
Domain Number 2 Region: 287-391
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-32
Family Second domain of FERM 0.000011
Further Details:      
 
Domain Number 3 Region: 202-282
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.82e-21
Family First domain of FERM 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017376   Gene: ENSGACG00000013124   Transcript: ENSGACT00000017410
Sequence length 996
Comment pep:known_by_projection group:BROADS1:groupXVIII:15163261:15182832:-1 gene:ENSGACG00000013124 transcript:ENSGACT00000017410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEAGSETEVKEKAEEPATQPDQSEKAADEAQEVASGEGQEKGKEGKGIGRYLPTWLKK
QKSQSQVTCFYHGSNRSRCEAPPTEDAVGEVTQKEEEPAPDVNGHAEEVEEGEEGEEEAV
KLEQVKEKESTANADAETADKVQEETQPTAEGEGAKEVQQTEAKKEEQEGDAAGEEEQRG
EGEGQTSIFQSPLRLVRKTKMKLMECHVSLLDGTDFTCEVEKRAKGQFLFFKVCEHLNLM
EKDYFGLFYMDNHAQTCWLDPTKDIKRQIRSNFYCVFSFSLKILPSDPSLLTEDITRYLL
CLQLREDVASGRLPCSFVTHALLGSYTLQAEFGDHEPDQPRTLGLGQLTFAPNQNKDMEE
KILELHKSLRGMTPAQADAQFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCANGLLVYKD
RLRINRFAWPKILKISYKRNNFYIKIRPGETEQFESTVGFKLQNHRCAKRLWKVCVENHS
FFSPTKARFLTLGSKFRYSGRTQAQTRTASSLIDRPAPNFQRTSSKRISRSLDGAFTRVC
VCVCVNFVLCAFFGCDQPDTGNGSSMCFLSRGEGGMESSENGREPHLELHSDSKSPMRVH
GDNIYVRHSNLMLEDHDKTQDDVLKHQASISQLKRSFMEAPPPSPPQPNQWEKRLTSSPA
TPIRVQQQVVLEIEETVVVQEVSIAPKPGRVAVTAGPPAGPPAQQEALEQEVTVGQEVVA
AEEAKAAKQESVSSESESEEEAEYHPNVSICHTKIPEEEEEEEEEQADKTAGAPPLVDEV
SAAVEESAPADARDEKNTEGEHQAEKDGSGEPAHAAAPNGPRVPEGSASGAEQDQEPKVN
GEARPVEAEHRPQVICCSEPPVVKTEMVTISDTFAAQKTEIATKEVPIVHTETKTITYEA
AQLDGNGDSEPGVLMTAQTITSESLCTTTTTHITKTLKGGLSETRIEKRIVITGDCDIDH
DQALAQAIKEAKEQHPDMSVTRVVVHKETELAEEED
Download sequence
Identical sequences G3PIE8
ENSGACP00000017369 69293.ENSGACP00000017376 ENSGACP00000017376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]