SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017409 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017409
Domain Number 1 Region: 129-221
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-30
Family Pleckstrin-homology domain (PH domain) 0.0000199
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-23
Family SH2 domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017409   Gene: ENSGACG00000013166   Transcript: ENSGACT00000017443
Sequence length 243
Comment pep:known_by_projection group:BROADS1:groupXV:15561560:15566543:1 gene:ENSGACG00000013166 transcript:ENSGACT00000017443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WYHYDLSRHAAEALLLSNGIVGSYLLRNSNKGPSFFALSVRAKDSVKHFHVTRKDNGYRF
GFNEFATLQDFVNHFANQPLLGSDTGTLMVLKCPYPWRVEEPSIYESVRVHTAVQTGRTE
NDLVPNAPSLGTKEGYLVKQGAFVKSWKQRWFTLNRYELKYFKDKMCEEPIRTLDLRACS
AVQFDYSQDRVNCFCLVFPERTFYLCAKTGVEADEWIKIIRWKLSFLRKIKTKRKESESF
VDS
Download sequence
Identical sequences G3PII1
69293.ENSGACP00000017409 ENSGACP00000017409 ENSGACP00000017409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]