SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017415 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017415
Domain Number 1 Region: 848-876
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000171
Family A20-like zinc finger 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017415
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.00105
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017415   Gene: ENSGACG00000013171   Transcript: ENSGACT00000017449
Sequence length 882
Comment pep:known_by_projection group:BROADS1:groupXX:15718618:15727964:1 gene:ENSGACG00000013171 transcript:ENSGACT00000017449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVDMDAVLSDFVRSTGAEPGLARDLLEGKNWDFTAALSDFEQLRQVHAGNLTYSFNEDR
AYLPLEKEMARLGRPVLHRQDEVVQAATEKRLSRGISHASSTIVSLARSHVSSIGGSSAE
PLLDTPLCTFQLPDLTVYREDFRVFIERDLIEQSMMVALEHAGRLNWWTKVVSNCQNLLP
LATSGDGNCLLHAASLGMWGFHDRDLMLRKSLYALMDRGLEREALKRRWRWQQTQQNKES
GLVYTEEEWQKEWNELLKLASSEPRIHYSTNGTNGAESLDEPVYESLEEFHVFVLAHVLR
RPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPAAKCHRSPLVLAYDQAHFSALVSMEQ
RDSSKDQAVVIPLTDSEHKMLPLHFAVDPGKDWEWGKDDTDNVMLASVALSLEAKLQMLH
SYMTVTWLPLPCEQQAPLAQPESPTASAGEDARTPPDSGESDKESVSSSSNNGSAGAAKD
KTKKDKDKDKDKDKDKKRADSVANKLGSFGKSLGSKLKKNVGGLMTGKNGGTAGAKQEGV
EKKKGSFRGRKGSKDSSPSAHASEDSGKGSPSSGSERLNGTKYSADVKVSLGILRAAMQG
ERKLIFASLLTTSNRQPFQEEMILRYLADAEERYRGEQEQQRRDAERKGVANGAQPPKKE
APGGTEGTYRPYEAREEPPENASPSFNQLKSSPLSPSMYSGVVPIPRPSFIDQTPVAGAP
LTQHLQMHYMDTRRQLAGGSPATSYPGLPSYATLPRHCPATQPPSHPQYNNSQGPASLSP
SRLAPSYPPDFDPPDYPGSELAGGCYTNGFRDLRSNLEPRSGQPPVRHYSLGSAGGLASR
QSSRCRTPNCTYYGHPETGNYCSYCYREELKKTEPDLVVHRL
Download sequence
Identical sequences G3PII7
ENSGACP00000017415 69293.ENSGACP00000017415 ENSGACP00000017415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]