SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017423 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017423
Domain Number 1 Region: 137-495,577-597
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.87e-81
Family Myotubularin-like phosphatases 0.00000721
Further Details:      
 
Domain Number 2 Region: 13-114
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000492
Family GRAM domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017423   Gene: ENSGACG00000013174   Transcript: ENSGACT00000017457
Sequence length 757
Comment pep:known_by_projection group:BROADS1:groupXX:15741034:15750570:1 gene:ENSGACG00000013174 transcript:ENSGACT00000017457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRKKLTAREGRGWVSGTLFCTHFRVAFVPQDNADPVLLGDHDVALASIEKVVVVGPNRT
KLVTPNSSLKFTPEELVLYCRDLRVICFLFDRLTPDAQVIEITYTIAKTYQPPKPGSVLS
FQNAALGSVGNRRRDTHMNWFESASDWEQELERCGATGWRVSSVNDRFEMSTSLPRSIVV
PQKVLDTELKKSFAHFHEGRIPRWCWRHPRGSDLLRMAGFQNNIYHEKDDIKNLEMILFG
CQSSLCVVVELDEELPSPADIQLSHGRLRALCLGDISTSVSVPDDRWLSTLESTHWLDYT
RACLRKASEVACLLRGGHLTVALQEADDRDMGCVVSSLVQVMCDPHCRTQRGFQGLVQKE
WVMAGHRFSSRINYHRDNDKEEAPVFLLFLDCVWQISSQYPTRFQLTEDFLLALHDSIHL
PLFSSFLANCQRERCKRSQSTQNLGQSYTPVNGWRDVDSSSDPSDPPLPSVWDWSLQYSK
HRRDRFTQPVPPIPSLQPPSDTVPGSVFLLSRGTFSCPVNLLPWRAGSSGVYKKSHRRAA
SSENVPGLERLLKAWAMAELPQGVTSTSAPQGPLDPYEPLLPLLMGPCMGLWKECYLRGA
LHAQAFSHPVSANHPHPVERLAREVQQLKDELARASSGADPIPPPKTAEPRRTDTNLNQN
ANNGTFLFPASRPQSASAPRAAPPPSSANRQTSRGPPPPPASAPPSRHGHHRDNGGGNKH
TFLFGHPPAAEPRPDQRYYPAPNAAKLPKSNGSSVAS
Download sequence
Identical sequences G3PIJ5
ENSGACP00000017423 ENSGACP00000017423 69293.ENSGACP00000017423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]