SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017500 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017500
Domain Number 1 Region: 755-848,884-971
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.24e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.0000844
Further Details:      
 
Domain Number 2 Region: 277-555
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.58e-47
Family FCH domain 0.0097
Further Details:      
 
Domain Number 3 Region: 683-734
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017500   Gene: ENSGACG00000013232   Transcript: ENSGACT00000017534
Sequence length 991
Comment pep:known_by_projection group:BROADS1:groupVIII:17169831:17179602:1 gene:ENSGACG00000013232 transcript:ENSGACT00000017534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARKKRELIKTPSITKKSRAGSPAPQSSAPSEQPRKDAAEGGRTPSAQHGKLAAGGPSP
VATLKRPTALSRHASAAGFPLQSWVFTKGQGRAASAPTTPSDGPESTAIEVEDIPALLRD
VARFAEAVEKLKDVVLAEGQRESQRPVAHECLGEVLRVLRQVINTYPLLNTVEILTAAGK
LISKVKGFHYEACNEADKKDFEKAIETIAVAFSSNVSELLMGEVDSSTLLSLLPTEKSRS
MENLYASAGADGGAFRSDLQDMGRAEEVDVILQNSEGGVDSALLYAKTISKYMKDLMSYV
EKRTSLETEFSKGLQRLYQSCKHSITHVSLQPHMPLFSIYSLALEQDQEQSIGLQQANTT
LHTQTFIQPLMQRKQEHEKRRKEIKEHWIRAKRKLMECEANLRKAKQVFMVRCEEYDKAK
TAACRAEEEGGGATAKSVEKKKRVEEEARNKADEAEATYRTCIADATTQQQELEHTKVTV
LRQLQDVIKQSDQTLRSATISYYQLMHMQTVALPVHYQTLCESSKLYDPGQQYAAHVRDL
QLPEQPTVHYDFENYCPSSSSSHGHRARNDSFNAEQTSPADAASGDNRDAEAQRKRQGHK
SWGSTVSDDSVGGEGGLESPTASTSDISKIVRTSSTGTMSSNEDADEKDVNVTSFESPNI
NGMDPDVVVSTRPFRNLGLSKAAQTHRLRKLRTPSKCRECDSYVYFQGAECEECFLACHK
RCLETLAIQCGHKKLQGRLQLFGRDFSQVAGCASDGIPFIITKCISEIERRALKMKGIYR
VNGVKTRVEKLCQAFENGKELVELSQCSPHDISNVLKLYLRQLPEPIMLFRMYNCLMGLA
KESLHGEAETPEGEESHRVVPVGCKAPELEDRGRDTDPEVLVLVEKLKELLKDLPKANIA
TLRYLIRHLRKIAELEQDNKMSPSNLGIVFGPSLMRPRPTGATISLSSLVDYPHQARIVE
SLIVFYSSIFQSKAPQSQRTCGSASTSTQQV
Download sequence
Identical sequences G3PIS1
ENSGACP00000017500 69293.ENSGACP00000017500 ENSGACP00000017500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]