SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017541 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017541
Domain Number 1 Region: 156-354
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 38-150
Classification Level Classification E-value
Superfamily PH domain-like 1e-28
Family Pleckstrin-homology domain (PH domain) 0.00031
Further Details:      
 
Domain Number 3 Region: 517-611
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000392
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017541   Gene: ENSGACG00000013273   Transcript: ENSGACT00000017575
Sequence length 622
Comment pep:known_by_projection group:BROADS1:groupXIII:16131688:16140819:1 gene:ENSGACG00000013273 transcript:ENSGACT00000017575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKLPRNWDFSTFKAETARIARSRSVIPGEGGLGPGSPRSPRSMERPLKSGWLKKQQRS
LVKNWQQRYFVLRGSTLTYHKDDKETTVQGVIQLRFSKVNDLPPNLDDPGKYLFEIIPRT
TKDRERCPYVFMANSQSDMEEWVRTLRKVIGVPTSGVFGKGLVDTVTYEQRFGPHMVPIL
VQKCVEFITENGLDEEGIFRLPGQDNAVKQFRDAFDAGERPSFPKDTDVHTVASLLKLYL
RELPQPVVPWAQYQDFLDCTNPLDFSSTQGWEKLQKQIALLPRIHYNLLGYVCRFLFEVQ
QHSKVNKMNVENLATVMGINLLKPQIEDPISVMKATPQIQKLMTVMIRKHDILFPLSEDV
LPSPPSKKTESQKNTPRSFVGWESAEMGDASLSESPEEEEDIDSPGPNRGDCSPQNTWQE
PRSTSTDDWTGSHRKRTQTLPTFNCPLTGMAAKAEALNRWSNIHENAEEKSGTLSEDIFK
ILDLRSSGSLFGGPQTSNKGGEVSPPACCVIRRMWAARWDQTSRSAGGLSRRRTASRLQT
GELSRQTLEQREGSVILQQENMELKATVAELQSALEAERRRAAALELCLRNAERSRDEAQ
RRNEELQRDIQQFLTKKTQAAT
Download sequence
Identical sequences G3PIW2
ENSGACP00000017541 69293.ENSGACP00000017541 ENSGACP00000017541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]