SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017544 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017544
Domain Number 1 Region: 43-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.91e-257
Family Motor proteins 0.000000000229
Further Details:      
 
Domain Number 2 Region: 2049-2139
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-21
Family Third domain of FERM 0.014
Further Details:      
 
Domain Number 3 Region: 1232-1335
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-20
Family First domain of FERM 0.029
Further Details:      
 
Domain Number 4 Region: 1953-2045
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-19
Family Second domain of FERM 0.0044
Further Details:      
 
Domain Number 5 Region: 1327-1420
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000497
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 6 Region: 1835-1894
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000372
Family Ras-binding domain, RBD 0.069
Further Details:      
 
Domain Number 7 Region: 1548-1616
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000359
Family SH3-domain 0.0032
Further Details:      
 
Domain Number 8 Region: 794-862
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000345
Family Motor proteins 0.03
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017544
Domain Number - Region: 6-55
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0777
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017544   Gene: ENSGACG00000013269   Transcript: ENSGACT00000017578
Sequence length 2154
Comment pep:known_by_projection group:BROADS1:groupI:17244095:17279920:-1 gene:ENSGACG00000013269 transcript:ENSGACT00000017578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYSSAQGDFVWLDLKTGREFEVPVGAVVKLCDSGQIQVQDDEGNEHWISPQNATNIKPMH
PTSIHGVEDMIRLGDLNEAGILRNLLIRYREKLIYTYTGSILVAVNPYQLLPIYTADQIR
LYTNKKIGEMPPHIFAIADNCYFNMQRNNRDQCCIISSGESGAGKTESTKLILQFLAAIS
GQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEK
SRVCRQALDERNYHVFYCMLKGMTAEEKKKLGLSKATDYNYLTIGNCTVCDGRDDMKEYS
NIRSAMKVLMFTDKENWEISKLLASILHMGNLRYEARTYDNLDACEVVRSSHLTTAAMLL
EVDGKDLMNCLTSRTLITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVEKINAAIY
KPTSSQPKALRRSIGLLDIFGFENFTVNRFPCCLFVDAVCLVIWYLCKLEQEEYNLENIN
WQHIEFTDNQDALDMIAIKPMNIISLIDEESRFPKGTDTTMLNKLNFQHKLNTYYIPPKN
NHETQFGIQHFAGVVYYETKAGFLEKNRDTLYGDIIQLVHSSKNKFIKQIFQADVAMGAE
TRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNENKKPMLFDRELCVRQLRYSGMM
ETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRIAEAVLGRDDDWKMG
KTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKMRKSAVFIQKTWRGYH
CRKNYGAMRAGFSRLQALVRSRKLCASYNVARQRITGFQGRCRGFLVRRAFRHRLWAVIT
VQAYTRGMIARRLYNRLKGEYRRRLEAEKMRLAEETKLRNQMSAKRAKAEAERKHQERLA
QLAKEDAERARLEPVNDSDMVDKMFGFLGTTVSFPGQEGQAPTGFEDLERSHRELEEEDL
DEALPLPEDDEEEDLSEYKFAKYAATYFQGTTTHTYVRRPLKQPLLFHDDEGDQLAALAV
WITVLRFMGDLPEPKYHTAISDGSEKIPVMTKIYETLGKKTYKRELQALEAEVHQTPPTD
NHKKNSVRHKLVSLTLKKKSKITEEVTKRLNDGEPGLHGNSMLEDRPTSNLEKLHFIIGN
GILRPGLRYTHKLVHCKQLSQNPSKSSHARGWILISLCVGCFAPSDKFVKYLRNFINSGP
PGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTA
KELCNALSDKINLRDRFGFSLYIALFDKVSSLGSGNDHVMDAVSQCEQYAKEQGAQERNA
PWRLFFRKEIFTPWHSPTEDQVATSLIYQQTVRGVKFGEYRCDRDDLAELASQQYYVDYG
SEILLERLLSLIPSYIPDREISSSRTVEKWSHFIMAAHKKGIYAQKRFDPQKVKEEVVDF
ARHKWPLLFSRFYEAFKFSGPSLPKNDLIVAVNWTGVYFVDEQEQVLLELSFPEITAVSS
SRGGKLQSQSFTLATIKGDEYTFTSNNAEDIRDLVVTFLEGLRKRSKFVVALQDNPNPTG
EESTFLSFMKGDLILLDQDTGEQVLNSGWAHGINERTNQRGDFPADCVYVLPSVTRPQQE
ILALVTMTPDQRQESVRVSQLVLPESDDRMKAYTLEEFSYDYFRPPPKHTLSRVMVTKNR
GKDKMWSCTREPLKQPLLKKVVNHEELAQDACMSFIAMMKYMGDYPSKRTRSVNELTDQI
FEGALKAEPLKDEIYCQTIKQLTDNHVKYSEEKGWELLWLCTGLFPPSNVLLPHIQRFLQ
SKKHHPLSGDCMQRLHKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVE
SGTKAKDFCQNISTRLLLKSPEGFSLFVKISDKVGSQQVFIRNFMRLFRFLAKWMDRLSS
QNDSLCECFTYKIFDGKKFLVGTDSVADSRYTHYHELPKYLRGYHKCSREEVFQLAALIY
RVKFEDDKSHFPTIPKMLRELVPQDLIRQMSPDDWKRSVVAYFNKQAGKTREEAKLMFLK
TIYKWPTFGSAFFEVKQTTEPNFPEILLIAINKHGVSLIDPKTKDILTTHPFTKISNWSS
GNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTTMNKQRSGPRLSK
Download sequence
Identical sequences G3PIW5
69293.ENSGACP00000017544 ENSGACP00000017544 ENSGACP00000017544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]