SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017550 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017550
Domain Number 1 Region: 553-799,840-955
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.97e-126
Family Oxysterol-binding protein 0.00035
Further Details:      
 
Domain Number 2 Region: 10-219
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-34
Family Ankyrin repeat 0.00057
Further Details:      
 
Domain Number 3 Region: 238-335
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000246
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017550   Gene: ENSGACG00000013256   Transcript: ENSGACT00000017584
Sequence length 961
Comment pep:known_by_projection group:BROADS1:groupIII:1085397:1100270:1 gene:ENSGACG00000013256 transcript:ENSGACT00000017584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEADALEATLLRCAKEGNCAEIQLLLESRTNRRSPLSVNCTSKAAASPGWTPLHLACFFG
RGGAVEQLLKAGADANVQDHVGDTPLHKAAFTGRQEIVLLLLRYDACCSIINGVAQIPKD
VTMDDEVITMLEAAETRETRRREKKLLEAAREGEIAALSKLLSGTEPPDIHCRDSVGNTP
LHCAAYRGQKQCIIKLLKSGASPTTKNSNDQTALDLVCSDELRPILAAYQAKSSAAQKIE
GRLWKSSRLVRWRSHWVIIEDGTISWYPKQADAMAGVRKQGCKSLKDATCMVKPWDPWFF
MLRCFDDTVYYFKVSSKCVTLSTQRWLDALEAHSSFSAGHCPPEPACNDADDDVTVRNLS
QALQAASTSQQKLHSEVSIFQSMVKNDENSEALAAPLLLKAKETSELSSGTCAALHLCLE
LLSEQEEVWSLKFEQEVEKNRALTEALQTLATENHQVERSRGKSRRSSVLSTFNEDDFYD
ALSESDSELSVSGFLSVAGHSGEEDEGRDSPLLSSLRRPGALGGPAGMSGEGNHGNQHNG
VEKHRTSLPTPMFSRNDVSIWGILKKCIGMELSKIAMPVIFNEPLSFLQRLTEYMEHTYL
IHKANATTDSVERMKCVAAFAVSAVASQWERTGKPFNPLLGETYELIREDLGFRWVSEQV
SHHPPVSAFHAEGLNQDFVFHGSIYPKLKFWGKSIEAEPKGLITLELPRYNEAYTWTNPT
CCVHNIIVGQLWIEQYGSMEVINHKTGERCSMMFKPCGLFGKELHKVEGYIQDKSKKKLC
AIYGKWTESLYAVDPVTFDSHKKTDKKSSDERKDNKRGSVDEEPEEMPPPDAETVPVVPG
SELIWKITPRPGNSAQFYAFSTFAMHLNEQDKSTEEVAPATDSRFRPDIRAMENGDIDFA
SSEKKRLEEKQRMARKNRSKSPAEWKTRWFEQGQNPHNKAQDWIYLKGYWERNYTDLPDI
Y
Download sequence
Identical sequences G3PIX1
ENSGACP00000017550 69293.ENSGACP00000017550 ENSGACP00000017550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]