SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017652 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017652
Domain Number 1 Region: 8-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.14e-19
Family Ubiquitin-related 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017652   Gene: ENSGACG00000013337   Transcript: ENSGACT00000017686
Sequence length 1180
Comment pep:known_by_projection group:BROADS1:groupXX:16125107:16134898:-1 gene:ENSGACG00000013337 transcript:ENSGACT00000017686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEQTADIEVTVKTLDSQSRTYTVGAQVNERFKEHIAPSVGIPVDKQRLIYQGRVLQDER
TLADYNVEGKVIHLVERAPPPPSQPGSGSGGTSADTGPSPSAQGTSQVPPHDRNANSYVM
LGTFNLPVNIMDPQHIQMSVQQMVSGMGETARNARVTTSTGTNGSVNVHIDMDQPVQSEP
RLRLVLAENLLRDINHVIHRMEGTPNEPSAPTDTSSTAADAAPPPPPSSSSTSSTPSPST
QPMDTSPPATTPPPPTTSSAQTEGPTPQPGPNHPSPAELAEMLSELRRVEERLQPFIQRA
HTILETATTAEYNNNSSQEREEDQRTLILTWECLRLLGNALVALSDLRLNLMSPVPRHLH
VVRPFSHYATPVTLPGAVHHHIPMQMNLGATVTVAANGTEGQAPPTQPATQPEQAGQGQT
PPTQTSPSNQQAGPGQAGPRVIRISHQAVPVVMMQMNTDECAGSGANPGAAGQQMPGQQM
PGQPGALPPDFMRNLMQQISQYAAAVATSAATANSSTTTTGPNTPTTTPTAPPPPPHAGP
QPQARVVFTRPPFAPNMPPPSFGTRGTTINVRAAMPGQQPGQPFNPAALNQMISGLVGQL
LIPGQMGNNAGQTSSSSAASFSFSNSSPTPPPTTSTTGPAGQSETNTSEPQSQEIPQDFS
DFLDSILGGAGGASGGPMGAPSITVTTSGVPAFIQGVSEFMQQAQPIFSPPQPSSGTAPA
AGTTPNPPAGAEALNPELFTGIVRGVLSTMMGSLGQAQNDTESIAQFMQRLSQATNIFIS
PEDPTGFFGELLMLVCQTFTMPDLVMLLHGQHQPLGRIQPQLSQFFTQNYLNGREPTDEN
ITAAAESLVNELEEYISESFRESSVTVLDGVDVTRTNMSFFRQQLMRIATHILRCTDDTF
GPRLLHMCNQALFECLALNLHCLRGDQRALTAVINHRIRRMSSDISPSLVNWMTSMMTMR
LQVILEHIPITEEQIQTYIVHTQTEQSSTGTQEPERAQSATIGDTLSPAAATTAEEAMSV
SHDTNLGASGGAAPLGGDMAAAGAEGGSVESARQSETWAAAVPPEWVPIIRCDMMTQRKM
KAQPPLSDAYLHGMPAKRRKTGLGGGSLLSLSDAVSQAARAAGVKPITSAERLQDDLESQ
ELKEAYAEQVKADIKKRVREDPDFNSQQSPNAHRAFSSDS
Download sequence
Identical sequences G3PJ73
ENSGACP00000017652 ENSGACP00000017652 69293.ENSGACP00000017652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]