SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017696 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017696
Domain Number 1 Region: 4599-4754
Classification Level Classification E-value
Superfamily SET domain 5.1e-44
Family Histone lysine methyltransferases 0.0069
Further Details:      
 
Domain Number 2 Region: 1007-1068
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000166
Family PHD domain 0.0047
Further Details:      
 
Domain Number 3 Region: 386-443
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000806
Family PHD domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1081-1152
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000131
Family PHD domain 0.021
Further Details:      
 
Domain Number 5 Region: 958-1016
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000886
Family PHD domain 0.015
Further Details:      
 
Domain Number 6 Region: 333-390
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000377
Family PHD domain 0.011
Further Details:      
 
Domain Number 7 Region: 1685-1732
Classification Level Classification E-value
Superfamily HMG-box 0.0000131
Family HMG-box 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017696
Domain Number - Region: 464-521
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000244
Family PHD domain 0.014
Further Details:      
 
Domain Number - Region: 268-314
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0465
Family PHD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017696   Gene: ENSGACG00000013375   Transcript: ENSGACT00000017731
Sequence length 4754
Comment pep:known_by_projection group:BROADS1:groupIII:1215901:1265072:-1 gene:ENSGACG00000013375 transcript:ENSGACT00000017731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMSSEDKTVEPSDQGPSPPPISVGATSTGSPAHADKRPRGRPRKDSVSPPHPRGRTRGKA
AVDEEDSMDGTEITEYQQALRTQIKSTYDSNTIEPSVVSQISTIPTICSETRQNDVCSRV
NSASYAIVEERLCAFCYCGGRSLLGQGELQVFSTTPQFEALFSHKGTGGSASASSDGDKT
TQPKTAGETTSGQREKTKRSNLSLCSSGSERCEEELDPASRSWDELSHVGLPQDLNVQSL
FESAGQCWAHQSCALWSEGVCEGEGQSLLNVDRAIDSGSTKHCAYCKRLGASVKCCAEGC
AQLYHFPCAGAAGTFQDIRSLSLLCPEHVELALHKFVDDVNCALCDSPGELLDQLFCTSC
GQHYHGMCLDMAVTPLRKAGWQCPECKICQTCKNPGEDTKMLVCDMCDKGYHTFCLQPAI
DSLPTNGWRCKSCRVCIQCGTRTSGQWHHTSLLCENCVQNQDPALCCSMCACILDPEHHK
DLLFCQTCKRWLHLECERQNSGQAEIHPGEDYVCSNCRPPAAEQALQAEDMDTGPELSPQ
PAPMHIDSETGLQPAPKHTDIEPGTQGSPEMHNDPKPELLAVPLHSDPEPVQATVQEENL
ATSAQKPGGSLFQKVIPLNRRRDCERTAAMCEVCHIAKRSTVENQLCLAVVALRTRVSAR
REICQQWRISLLDNPATIIGAKTEARPEQGAADPSTKDFKAIISTTKEPSTASVPFTDQP
MEVSHPEPSSMDGRNPAETVTPSASGPSVEMYVTTESKSNVSFPCLPAEEKPLKTSAERL
AEMVSSPCHSSPLGRGTSPRELSQSLPLLGDHSGVIPTTTLIPLTPKIGMGKPAITKRKF
SPGRPRVKQGAWSPHSSVSSPLSWSPDQQEGWDVSKTRQSSGSPGWSIRVGRGSGFPGRR
RPRGAGLSGRAGRGRARGKNGVSPGMNPGVTTIETPYLVKDEEENAMHNTVVIFSSNDNF
TLKQDMCVVCGSFGLGAEGRLLACAQCGQCYHPFCVGIKITKVVLSKGWRCLECTVCEAC
GQATDPGRLLLCDDCDISYHTYCLDPPLQNVPKDSWKCKWCVSCTQCGATTPGLRCEWQN
NYTQCAPCASLATCPICLLDYSEGTVIVQCRQCDRWFHASCQALHSDEDVEKAADNNFDC
TMCRAFKSTKVVTKARDVIEPVVMTQIVTKAKEMDLSRTYTQDGVCLTESGLCQLQSLSA
TASRRRKPKPKLKLKIINQNSVAVLQAPVDPLSEHSRDEDIEDNREAELLDCEAKSDSSL
EREPAEEDSKGPDGGKKRKRKPYRPGIGGFMVRQRSRPGQGPGKAKRALCRKDSTGSMSE
NPFGKDEGWTETLPNTPVDETPPGPEVPEKIKKRYRKKKTKLEEAFPTYLQEAFFGKDLL
DKSKQRRQQGPESGLMDDGQSQGKRKHPTTSFLDPSSDPLLSASATSLPARPAAAQTAEE
PLVDLSDVLNTDADILGMLGKPSSDSAGLDIGALADGSPVALQSQAGRRTPRTLPEEPLD
GILSPELDKMVTDESILSKLYKIPELEGKDVEDLFTAVLSPSTSRPPLPQVPHPQGPGSL
PATPGTSISHPNAGNSMFPRMPMINGMMGPNQRFPSNPGAGPCIPEDFAPLNRMPFTDNP
RDRKFNQMPREAVGPWLSPSHGAGPTTPGPLPEGETEAMSNAQRSTLKWEKEETLGELAT
VAPVLYTNVNFPNLKEEYPDWSTRVKQIAKLWRKASSQDRAPYVQKARDNRAALRINKVQ
MSNETVKRHHPQQQPPEVFDPNIPLDTELLFKDPLKPKESEHEQEWKFRQQMRQKSKQQA
KIEATQKLEQVKNQSEEDGNNSGNQSPASQPSNGSMSPIQQLNSKDGFARPQLPGTPTSG
PPEDVFLRPPPPPPSGSSSQPQSPQVFSPGSSGSRPSSPWDPYAKMVGTPRPPNTCRRMA
VESGKSPTSLMEQQDRGRPSPVNESFGSPTSMSSDPYAKPPDTPRPTGEMDPFLKPMGPP
RASQAAQGRPPMGSPGRDPYSRPMIRNEAYQRMAQNRMILSDPYSRPLLTPIPGSNESGS
VPLFKTPMPPPQAQDTFNRPGPYPTDRFSQNQLNDPYAQPPHTPRPCGNDNFTSPPRMGQ
HHPQVHPFSQDPFAQPPGSNKPATDPFSQSTGNQRSMNEPYARPPGTPRPHDNYDPYSQA
PSTPRPSGMNQFTHQPHHGQRMSPSHSVDPYAQPPGTPRPSVGDRFSKSPGSQRGTIEPF
TSTPGTSRPGSSDMFPQPGASRPMLSDPYAQPPGTPRPGPDVLGRQGPRRPIQTPGHDPY
EQAPMTPRPQSMEKMEMKDQSFLGNNGTVLHDPGHLSNNPQMHGTSSEGVALAESEERLR
QRQRIRELILKQQQQRSAIRQERGPQEPAGIITPGAARPWPQEGPGHQGEMFNRPPPPYP
GQGPMRGPMRFPGPFLGNQRGPFPNDGQLPRGPHPGDPSLRHPGPRFAFPPGALGPHGAQ
EFFPRGQHPMQDVPPQMRRSMSAEMAKNMGGNPMGLPQHFPPRGMPVQQHNIMGQPFIEL
RHRAIENRSRMPFPPGAMQGSHMDLNLQGQRLPGFQGTPDSRFPFNQGARMMDPMASNSG
HVQLSASMDNLHQHAQMSGNHALRQSHLMRSMSQPASNETQNMAASMILTAHPAGQTEGG
SVSGSEGVEEKLDAEESAVKDLEDVEVKDLVDADLENLNLDPEDGKDLDLETNDLHLDDF
LKSGKFDIIAYTDPDLDDIKKDMFNHELDLSDPMDDSADTTDINKNTCTGSGASSSSASL
SAMSESSGVQSVAEVKLEAPGSQDSASLALGQEIKMEVKDCKQLSDVVDQQTSNQQGGLS
DSTPVLSGLLIKQQPEEQSLNPIIESVSQGVNLMPQPNQATDTGLTDTAGETSMSDFGED
GLDQSVLDQSGLMLAQQVALSQALGQHGQLHRPLLLEEQPLLLQDLLDQERQEQQQQRQM
QAMIRQRSSDSFFPNIDFDAITDPIMKAKMVALKGINKVMVQNNMGMAPMVMNRFPPGPP
PPCPESTPLPPQVVGQDGKLTQVARPTPPNFGPGFVNNAQRAQYEEWLQETQQLLQMQQK
FLEEKIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQGVVQKQLEQIRKQQK
EHAELIEEYRVKQQQNNMTPVLPGMHPMPGPAGMVPSGPPNVQPPLNPIMQMPLHPGPPN
PPPCNPNPPPGWHPGAPMPMAGPGMPPIMHPQHSQMPVDPQAPPAPPGGVKPVQGGGVKF
DDNNPFSEGFQERERRERLREQQERQRVQLMHEVERQRALKHRMEMEQQGMMGPEGNMAP
LAQMPFFNAELPQDFMQPQRPPLQQQQQQLAPMFPQQQGMQPGMGSPPGAFMQGERRAMM
GNGMMHRDMGPGLGSDNVGLQAPNFAQCQQRPRHFSGPGLMLPMPGEGPPFGGDSATPLP
SNFPGSGQSLIQLYSNIIPDEKGKKKRNRKKKKDDDADSVKTPSTPHSDLTAPLTPCVSD
TSSTPTRNTHLFGEQDLSRSPLLGSSTPSHSELERQLSGGQSGHHGVLSDAARTQAQEHD
RILNNIKLEQMDASECHGPREGPIGSEMSYVKQEGKKGSVSPFPAGQSPNKGEAGNELLK
HLLKNKSTPPSGLSQQRSEETMRLEEEELADCKALLRQSSMDSNGVSLVSLCLQAYSDGT
QDFAGTVLLEQEKKKGRNKRAPKGGEKTTSRYKKRKKEGDERQLMHSGPDTVMSQIKQQS
NLSNPPTPPASLPPTPPPVNRQKMINGFATTEELASKAAALVFHTVSKGLVPKPLHVPFR
TEEDLLARAIAQGPKTVDVPASLPTPPHNNQEELSNRGQEPCKDRDTPDSFVPSSSPESV
VGMEITRYPDLSLVKEEPRSPCLSPVLPMLPAPDGKGSQIKLQDIKTEPSAMFFGSPFGS
MSNDSKQGLVSVAITLRPAAAENITGVVAAISDLLCVKIPSSYEVSSTPDRGHPSMLSGP
RVGPHGMEPRLFHGQVDNGGLHGRPGQMMRPSGAHAMMQQQQAHHFRFHPNSPGAALARG
PDQRPPASPGCKPHWCCHCKVVVLGNGVQKSIKDLPAHMKVPNESGARLKSEDLVFCSHS
CFLLYCSSSPLQSRSTTETKESVSLLPDPDQTESLSKILHQYSNNMSSLDVHCLAQLQPK
QSPPSTPPIPFPMADETAKMDIKSDAIKVTMKLKARPRSHDGWHQGKRQKGLRWRKWTVQ
VLVPRGNSQLPDEDKIDELLKKLGASLRPPASLRDRRRCCFCHQFGDGITDGPARLLNLD
LDAWVHLNCALWSTEVYETQAGALINVELALRRSQTVRCAYCQQTGATSGCHRLRCTNVY
HFTCALHAHCTFFKDKTMLCHAHRPRGTAGQALEHELRCFAVFRRVYVQRDEVRQIASAV
RQPELGYTFRVGSLVLHAVGQLTPLQMAAFHSSTAIFPVGYEACRIYWSMRHGNRRCRYV
CSVEDREELPEFTIRVIEQGYQDLVLTDTSAKGVWDKVLGPVAEKRNEAGTLKLFPVYLK
GVDLFGLTVPAVVKISESLPGVEACVRYSFRYGRNPLVELPLIFNPAGCARAQPRTSSPS
TSLVIRPHPQAVSSSSARSNQNVAQGEGGAPHSKPPVVHPRSSQYRWMKSEWRANVYLAR
SRIQGLGLFAARDIEKQTMVIEYNGTVLRNEVAISKEKSYKSQNRTVFMFRIDSEHVVDA
TRTGGLARYINHSCAPNCVAEVVTFERGYKIIISCNRRVEKGEELCFDYQFDTAEGQHKI
ACQCAAPECRKWIN
Download sequence
Identical sequences G3PJB7
ENSGACP00000017696 ENSGACP00000017696 69293.ENSGACP00000017696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]