SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017713 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017713
Domain Number 1 Region: 1017-1213
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.000026
Further Details:      
 
Domain Number 2 Region: 800-926
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-25
Family Pleckstrin-homology domain (PH domain) 0.0000188
Further Details:      
 
Domain Number 3 Region: 25-147
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-17
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017713   Gene: ENSGACG00000013399   Transcript: ENSGACT00000017748
Sequence length 1783
Comment pep:known_by_projection group:BROADS1:groupIII:1344013:1364222:-1 gene:ENSGACG00000013399 transcript:ENSGACT00000017748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVKQCSALRDASGRSDETSSVREEEPFSWPRPKTVRLRRTSQGFGFTLRHFIVYPPEST
AHCFPGNEEDHGLRAGRQWNRLEPMDTIFVKQVKEGGPGHGAGLCTGDRIVKVNGASIIG
KAYCEVISLIQDSGDFLELCVMPKDEDILQLDRTKETTDLAYSQDAYLRCRSSYSGNACH
IPEPPPKCYPRVDCKPTGMAQATDAAGQVCRGPTAPPDHGYRKEISVPPSPPPQPYLKSQ
TAACMRGDGVRTMVVLPDSGQIGRMGPTHRMDFMDPVFVRGRPGSLAQYPLPRKADVYPA
MVQYGGMPPHYPGNNQNIDWRTYQTYREYIDNKGIHSHGSRTIQERLDNLRASSQAAFAT
GYHIPRGDCGPKGLRRRSISHERSCQGPPPHFHIAPRSASQDRMSGAERMGQSRNWPPRS
VSQDGLTHKARAHSTDYVDPAELARPNERRAGYARADQGTRPSRQSVPRHAVLHRPSAAF
SGSMRGAPGASLYAKGPDSLQSRSSPMLLDRHSHYVKSTSAERSLTDQRVSVKGKRGAHA
IQQGQSRIQAGEPGRDAALAGHRSPSCSTSKHVPQRPSILKPPHPGTQSQVNGRSPTESG
VVLREKQPPGKNPSPLRHHSYILAVNDDGPDSTADVAACWLPNDARREIRMRRLEEQCHT
SCSSNLDESLDSIPFIDEPISPSVDREAAPIPPSAVISVAPSMATGPSSPGSPCPTIRRQ
LSHDQDSLRSALLESDAASKTERSKSYDEGLDNYQDEGRSNVRNKTVIYSHLQTLDGHKS
SGDSGSRRESSADIFANSSKEGLLNLRQLGTDKNKRVGGGMRSWKPMYAVLQGHALTLYK
DRKDAVSQASTPSDEEPLRICITACLIDISYSDTRRKNVLRLTTSDCEYLFQAEGREDML
SWIRVIQENSNPDEENAAVTSQDLISRKIKEYNMMSTPSSRSEPSPKSSRQSLSIKQAFL
GGKTEGKSHSPHSPKAGEDRRALRDDSSPPRDRAAWKIGIAGIMRKPFEKKTPAGVTFGV
RLDDCPPAQTNRFVPLIVEVCCKVVEERGLEYTGIYRVPGNNAAISSMQEELNSKGMTDI
DVEEDKWRDLNVISSLLKSFFRKLPDPLFTNEKYGDFIEASRTEDSVERLKELKRLIEEL
PDYHFETLKFLCAHLKKVSDNCEKNKMEPRNLAIVFGPTLVRTSEDNMTNMVNHMPDQCK
IVENLIQQHDWFFTDDGDEDPITTAEQESTVHSQPVPNIDHLLSNIGRTTASPGEVSDSA
CSDSSKSKQGLWGSGKDQCSKEMLRSSFFASRKRKKPKDKAHPSSSDDDLDAVFPKKELA
EESQPRPAWSPDHRTRSEGHTDKTAEKVKHRLGSEKLPDKPKRKESLSCSMISQPSPCRP
PEQLSSPPGRGSPDASPARSPDLGYRLPMAHQYSPSDPPSAYDDTVSDLGTMNSTSSQAS
VPEARRETEACPGGPGAEVCSITSDYSTTSSMTFLTGAELGTLSPEVQSVAESRGGDDDA
DDERSELVSEGRPMETDSESDLSVFTAGKAEPGAPRPLPTYRLIEGDTLSRKKAAQQKTA
SESSLDAAAWCDKDPKRLSRASGCAAGVSTGSLGSSSRGELDKAEPAWKLKITDRLKVRL
RTSVDDMFGVGSQRSRSPEGRGKKKNIRRRHTMGGQRDFAELSVLGDWSQHIGSASRSEL
SAVDQLKPKCSSQDFSIRDWIVRERHRTSNPEVSLEPSEQQGAQCGAHGHGLGASSSSEL
RRRSADVLSGDAPQGKNLSLSATAHPHKLTNSQVVNSRFYQCL
Download sequence
Identical sequences G3PJD4
69293.ENSGACP00000017713 ENSGACP00000017713 ENSGACP00000017713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]