SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017745 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017745
Domain Number 1 Region: 1063-1232
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.000045
Further Details:      
 
Domain Number 2 Region: 488-705
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-43
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 5.62e-28
Family Bcr-Abl oncoprotein oligomerization domain 0.0000688
Further Details:      
 
Domain Number 4 Region: 720-789,846-880
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000022
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 5 Region: 923-1049
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000125
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017745   Gene: ENSGACG00000013417   Transcript: ENSGACT00000017780
Sequence length 1283
Comment pep:known_by_projection group:BROADS1:groupXIII:16354617:16377267:-1 gene:ENSGACG00000013417 transcript:ENSGACT00000017780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEQVGFVAAWKAQFPESNPPCMELNSLGNIEQELDKCKSSIRHLEKEVNKERFRMIYLQ
TLLAKERKSYDGQRWGFKSTSRINDGDPPGGPESQRPHSEEAQVEEEEQQQRGPCKTSRC
KPHPEGDVGRVSPVHQDPEIPEFQLGTGSVAALRSNFERIRRANSHAAGDGRGSSVTGAQ
EKPFYVNVEYHSEQGLVKVNDREVSEKIRTLGGQAMQMERKRSLHSLPVNLSAATGDIGR
GLQRGGSTGGNCGHNGSYDDIAEVNPNVLKDGVSRPAGGKREPQPAECRPYTSVYVGGMM
AEGDTRVIHIRDHGTEDDAHLTWPRRSYSNGSFEDAGGGYTPDCSSNENLTSSEEDFSSG
PSSQVSPSPTAASQAYSEKSRSPSQQSFGSSSPPLSQKRLKQQGTASEATVAGVCRTRQT
RPSDGESTTSSRTSRDNSVQGDLGSETPASYGYELERSEELQTHRHPPSLSGSPSSSPRL
RSKSQSSRDTQSSGSLESTQSVELDQDKGMEMRKLVLSGILASEEIYLSHLEALLIPMKP
LRAAATTSQPMLSIQQIDTIFFKVPELHEIHKDFYDALLPRVKDWGPQQCVGDLFQKLAS
QLGVYRAFVDNYKVAVGTADKCCQANAGFAEISEDLKVKSTKDCKDQLAKISLETLLYKP
VDRVTRSTLVLHDLLKHTPSSHPDHPLLQDALRISHNFLSSINEEITPRRQSMTVKKGEN
RQLLRDCFMVELVEGSRKLRHVFLFTDLLLCTKLKKQAAGKGQQYDCKWYIPLADLTFQA
IEDCESSPIPLVQDEEIDAIKIKISLIKNEIQKEKRTTKGPKGVERLRKKLLEQESLLLL
MSPNMAFRVANRNGKGFTFLISSDYERAEWREIVREQQKKCFKSSSLTSLELQMLTNSCV
KLQTVHTVPMTMNKEDDESSGLYGFLNVIVHSASGLKHSLNLYCSLEVDSFGYFVNKAKT
RVYRDSTEPNWNEEFEIELEGSQTLRLLCYEKCCHKTKQSKEDGEIADKIMAKGQIKLDP
QTLQNKDWQRTVINMNGIEVKLSMKFTSREFSLKRTPSRKHSGVFGIKINVVTKRERSKV
PLIVRQCVEEIERRGMDEVGIYRVSGVATDILALKAAFDSNNRDVSVIMREMDVNAIAGT
LKLYFRELPEPLFTDDLYPNFAGGIALSDCVAKESCMLNLLLSLPEPNLVTFLFLLDHLK
RVTENESVNKMSLHNLATVFGPTLLRPSEKDSKISNSPQPISMNDSWSLEVMAQVQVLLY
FLQLEGIPAPDSKRQSLLFSSEV
Download sequence
Identical sequences G3PJG5
ENSGACP00000017745 ENSGACP00000017745 69293.ENSGACP00000017745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]