SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017803 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017803
Domain Number 1 Region: 563-786
Classification Level Classification E-value
Superfamily VPS9 domain 9.02e-49
Family VPS9 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 92-195
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-16
Family SH2 domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017803
Domain Number - Region: 803-888
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00145
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017803   Gene: ENSGACG00000013466   Transcript: ENSGACT00000017838
Sequence length 912
Comment pep:known_by_projection scaffold:BROADS1:scaffold_61:851484:871152:-1 gene:ENSGACG00000013466 transcript:ENSGACT00000017838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSTMTQPPRQERKGSFFKLIDSFACEIVTLKKEMGKKKVAEEDHVTDPLLGLGEEVGG
LFYQASPCTGIRAGLVGARDSGYDSLRRRLSVLDRLVQTHGVWLQLGLSHQDATRVLQSR
PDGTFLVRKSTSLQKKVISVRMNKDSAVPVKDFPVKESQYSFSLVGSGLSFADLFRLVAF
CCISRDVLPFTLKLPEAISSATTSADLEEVAKLGAGFWDAPAGHRRTESLSSSGISAPER
PPPPVCLTNSPRRPRLRTRTPSELESCQSNGALCFINPLFIKVHQPEGDHSSTTATAKIS
ATDSGQRSPPPRPPPPRLAAPLQQHSMPEKISWINVPKEKDSPISIPRPSLPISLSSLSS
SPRRLNASPSSSQEDAQCHLALEEQTIERAESSSPSDSATMTTSKQADGTGGHKEEGGEE
CSGGSQRLSDMSLSTDSSDSLDFSQCSAFFLTEDDEDDEEEPDYGVSLESDQDQDLTMVP
PGHRMKRRPSAGALILQRALRGHLRKMSGVFNSLLTPEKRAVRRVLELSRDKGSYFGCLV
QDYLSYMGEGAGTQAWQGYASGLELLQTLRQFITQMKSYLRQSSELEPPIESLIPEDQID
GVLEKAMHKCVLKTLKPVVSAALQEFQVRSGEWRQLKENLSLAKARQPQEMGVADTPPPD
PTAIEKIKHKFHTMSKLYSPEKKVTMLLRVCKLIYTIMEDNSGRLYGADDFLPMLTYVLA
QCDMPQLDNEILYMMELLDPSMLHGEGGYYLTSAYGAMSLIRNFQEEQAARVLSSETRDT
LHQWHRRRTTQRSAPSIDDFQNYLRVALQELDSGCTAKTLQVRPYASVEEVCRLCAQKLK
VADPENYGLFLLMEGSSQQLAADTHPQKIKAELHSRSQSTPFHFVFRRVADSKASSSAPP
ELMANLNDLTMT
Download sequence
Identical sequences G3PJM3
ENSGACP00000017803 ENSGACP00000017803 69293.ENSGACP00000017803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]