SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017883 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017883
Domain Number 1 Region: 151-262,302-573
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-150
Family Myotubularin-like phosphatases 0.0000000357
Further Details:      
 
Domain Number 2 Region: 1090-1155
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 51-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000145
Family GRAM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017883   Gene: ENSGACG00000013531   Transcript: ENSGACT00000017918
Sequence length 1171
Comment pep:known_by_projection group:BROADS1:groupXIII:16530944:16545495:1 gene:ENSGACG00000013531 transcript:ENSGACT00000017918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEEEGQQSLVCIQANQIFPKKSPVLEEENMQVPFPELHGEFTAYVGRAEDAIIAISNYRL
HIKFKESVVNVPLQLIENVECRDMFQLHVTCKDCKVVRCQFSTFEQCQEWLKRLNAVVRP
PSRLEDLFSFAFHAWCMGVYAGEKEQHSELCRPGEHVTSWFKNEVERMGFDTQNAWRISD
INSKFRLCPSYPQQLLVPAWITDKELENVAAFRSWKRFPAVVYRHQTTGAVIARCGQPEV
SWWGWRNADDEHLVQSIAKACATDSSARKHLSNGGYTNGTDLPDTDFESSMTNSSEVETL
TQPHKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRKSFQSLRFLC
TQMPDPANWLSALESTKWLQHLSLLLKAALLVVNAVDRDHRPVLVHCSDGWDRTPQIVAL
SKLLLDPYYRTIEGFQVLVETDWLDFGHKFGDRCGHGENSEDLNERCPVFLQWLDCVHQL
QRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLFNSGKEREDRHVQERTCSVWSLLRPANRT
LRNMLYSSHSEIVLHPVCHVRNLMLWTAVYLPSSSPTTPSDDSCAPYPVPGGNPEDAPLG
RRPKTRSFENLPSACELGSSLAPNRRSSDPSLNEKWQDHRRSLELNMAVGPEGGGNPDQE
ARPNGEAEEADLSVVVAVAEGQMENILKEATKEEAAAAVQREASAAATRVTDTVDAESEK
VAKGEEDSPCAEVNGTDAQREAIANGHHSLNGGVEAEEDAASPPLPAQMPGEPDQRAAEV
TQAPEDLEQQNSSVHEELRPCDSRSDEPDEPAAHRTLTNGFVDRSPEEPDADEETCPASE
PDHAVSGAVEQLDKRPSLMESSTETLTEEPCSDPPPCPRKEKGLEAGELGFIRTLNGATR
RPSASAFQSVSADLSRDGLCDSESSDGEPCGGHHWTKVNGERVSLSRQVSLASCNSLILH
PRGNCSQHRWCHALLGRAAISPEQPSRSHLDDDGLTLHTDVIQQRLRQIEAGHQMEVENL
KKQVQELWSRLENQQHTGFHRTNGDTGDEATLSTDSECNLDPNCLSRCSTELFSETSWEQ
VDKQDTEVTRWYPDHLAAQCYGCESRFWLVARKHHCRNCGNVFCASCCDQKLPVPSQQLF
EPSRVCKTCYGSLKLSPAPLELEKPITTSSD
Download sequence
Identical sequences G3PJV3
69293.ENSGACP00000017883 ENSGACP00000017883 ENSGACP00000017883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]