SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017888 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017888
Domain Number 1 Region: 576-614
Classification Level Classification E-value
Superfamily WW domain 0.000000935
Family WW domain 0.0035
Further Details:      
 
Domain Number 2 Region: 195-229
Classification Level Classification E-value
Superfamily WW domain 0.0000142
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017888   Gene: ENSGACG00000013528   Transcript: ENSGACT00000017923
Sequence length 963
Comment pep:known_by_projection group:BROADS1:groupXIX:18038085:18045819:1 gene:ENSGACG00000013528 transcript:ENSGACT00000017923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKNRLTGGAVGRRTILQLSPPGLRGGNVGERVLPRMAVDPSVISCTPRVSPLRLTCVS
VRMLSVWENNADEQEVDGHRFMRERLTNMKTAAVKATEGLSLLGAYEDSDEEEAGDALPL
STAKSTDIDSTLANFMAEIDAITTQPNSEDATPPSVPTAAPPRPDVDTRQPAASAAQNQQ
SAEFEYNTQCSLSGVGVEMGDWQEVWDENSGCYYYWSTRTNEVSWELPHYLADQVQTLGQ
NTNRSQVKTFRGSFVARSINGQRHSACSLSGPRKMPTFVVAPLSREEVIESVVGLTSEEE
ERHGVAASLLGPLIPSEVKESEERWRKKLLKGLDETENSLDSDGEGVRSAVSQSTPPLDP
DPIPTVQKDVCHKDLEDNSDAEEETEEDTMELELALERKKAELRALEEGDVSAGGSSPCS
ETSQEASGSRGILLKKKRWKTAFPSAPSPESNSIGSDLQDITETIAVSKAQESVKEVEDK
ETDGSEEKALTIPPVKEEVETPELKVETPELKFQIGELANTLTSKMEFLGINKRAISNFQ
FLLLQTETRIADWREGALNGVYLRRRLQEAAEHIKYYELNATPKGWSCHWDREHRRYFYV
NDRTSASQWDFPKEDKEEDLQGTETQTSSQENTKTLTASPGGVAGQSLSSGLTAETCGLH
NKKQNNVTKLSESILVIFFNEFERMHERRSKYKQAYAPDSDEEIMEVEMEMDDDNDSEPP
APGTEEDGSARPPLPPGSAGVKIVESSVPLGKGQKRKAGQLSKSITIGSGAILYTQPAFS
AGKKGSQHLLLNDVLPQYAYLSAPRPLKPDQSPVRAAPLISATAYWGVPAVPAPLVPCEP
PLPPVPALPPQPPLPPIQPPSEPPGVKAPAADKTKKIKKDKSKKSKIKMPSLVKKWQSIQ
KELDEEEKSSSSDEDRDQLNKRSIEDWKTQQLMTGKASKNANFETLPDNWRDRLKKRKTT
KNT
Download sequence
Identical sequences G3PJV8
ENSGACP00000017888 69293.ENSGACP00000017888 ENSGACP00000017888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]