SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017892 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017892
Domain Number 1 Region: 950-1007
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000558
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Domain Number 2 Region: 1034-1087
Classification Level Classification E-value
Superfamily PH domain-like 0.0000379
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017892
Domain Number - Region: 784-873
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00162
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 148-242
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017892   Gene: ENSGACG00000013534   Transcript: ENSGACT00000017927
Sequence length 1622
Comment pep:known_by_projection group:BROADS1:groupXIII:16549828:16573025:-1 gene:ENSGACG00000013534 transcript:ENSGACT00000017927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEPEISLFQGKMSDLESVLQQKDIELKASETQRTILEQDLATYITECTSLKHSLEQARME
VSQDDDKALQLLHDIREQSNKLQEIKEQEYHAQVEEMRVSIRQLEEDLSAARRRSDLYES
ELKDSRQNSEELKRKSADYQHRMQKVKEQGKADTEEMITKMEKTSVEQQTKIQDLQEKLA
KSLKATAEATDLLQSMRVAKDRVERDMERLQHKEDSSDSLRRRLRETEDGRKTLENQVKR
LEIVDRRENKLKEEIQSKALQIQQMAEKILALEDNLRETQGTGQRLESHLRQKEKLYEEK
IKVLEAQMKADMADKEMLESSQSRYEEEVRDKCSIICEQKATINAMDSKMNSLEQRIAEL
SEANKLAANSSIYTQKNMKAQEEMISELRQQKFYLESQAGKLEAQNAKLEEHLEKMSQQE
QSNKSRLQEQETKLREIGLEHEEQKLEIKRQVTDMTLSLQERQSQISNLQAARHALESQL
QQAKTELEDTTAEAEEEITVLRAHRDEIQRKFDVLRDSCAVITDLEEQLTTLTQENAELN
RQNFYLSKQLDEASDDREDRLHLGQDVDRLRREVADREMHLNNQKQNLGTLKTTCTMLEE
QVLELETLNDELLEKERQWEAWRTTLEDEKNQAERRTRDIQRLLDTEKQNRLRSEQRNAE
SRQALEKAVKEHKAEIMSLQQALKDQTLKADSLADTLNDLEKKQAMLEMNALTWQQKLES
ERDLKQRLLEEQEKLQQQMDAQKTHIFRLTQGLQDALDQTDLLKTERTDLEYQLENIQVL
AVYSHEKVKMEGTITQQTKLIDFLQAQAHGGSKKKKGLFGRRREDLLAAMAAQPVPLQYS
DMKIALDKERSRCSDLEEALQKMRAELRSLREEAPALPYKDHGNSANPASARQQMIMSAM
VKSPEHQQGPTALAPSNSERRKAAATPEEFSRRLKDSQRDRDRERERPVHHNNTPHRFTV
GLNMRAAKCTVCLDTVHFGRQAATCLECHALCHPKCSPCLSATCGMSSDCSLHLSEGPCR
DKGSSPGQQVKEASGHMHLEGWMKQPRSGKRGQGWERRYMVLDGTKVSIYETEPREDSVK
PLEEFDMCLSDGEVVVHGAVGASELPNTAKSGTIHKVLKSLHTVFRLLSPASFPQDQGSE
SGFPPAAALVCVFNPPAAPSAPSMETQDTRLTHKLLGNSLLKLEGDDRLDINCTLPLTDQ
IVMVGSEEGLYALNVIKNSLTHIPGLGSVFQIHIIKEQEKLLMIVGDERALCLVEIKRVK
QSLAQSHLPSQSELAPYIFETVKGCHLFAAGRIDNGPCICAAMPNKITILRYNENLNKYC
IRKEIETLEPCSCIHLTSYSIIIGTNKFYEIEMKQFVLEEFLDKNDVSLVSAVFAASSHS
FPIAIMQVASSMQKEEYLLCFHEFGVFVDTYGRRSRTEDIKWSRLPLSFAYREPYLFVTY
INSLDVIEVQGHASLGPTVLAHLDIPNPRYLGPAISSGAIYLASSYQNKLRVICCKGSLI
RETGELQRTGSSRGSPSKRGPPTYSEHITKRLTSGPGSHDGLHREPSTPHRYREGRTEFR
RDKSPARPLDREKSPGRVLDGRRERSPGPRFGDSGRLHAGSVRTLSRPRQQVMLKVWDQS
SV
Download sequence
Identical sequences G3PJW2
ENSGACP00000017892 69293.ENSGACP00000017892 ENSGACP00000017892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]