SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017904 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017904
Domain Number 1 Region: 734-921,1230-1313,1486-1547
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.67e-102
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000875
Further Details:      
 
Domain Number 2 Region: 178-355
Classification Level Classification E-value
Superfamily EF-hand 1.17e-26
Family Calmodulin-like 0.0015
Further Details:      
 
Domain Number 3 Region: 370-424,517-584
Classification Level Classification E-value
Superfamily DUSP-like 4.45e-19
Family DUSP, domain in ubiquitin-specific proteases 0.0058
Further Details:      
 
Domain Number 4 Region: 13-165
Classification Level Classification E-value
Superfamily EF-hand 0.00000000294
Family Calmodulin-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017904
Domain Number - Region: 646-704
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000557
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017904   Gene: ENSGACG00000013540   Transcript: ENSGACT00000017939
Sequence length 1585
Comment pep:known_by_projection group:BROADS1:groupI:18441588:18479552:-1 gene:ENSGACG00000013540 transcript:ENSGACT00000017939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKESRIGFLSYDEAVKRVTDVELKRLKDAFKRTSGLTYYMTQQCFYKEVLGDGVPHKV
AEVIYTSFGGSPKGLHFNNVIVGLVLLTRGRDEEKAKYLFSLFASDLSGHAAREDIEAVL
QVLDGEVPTSLKKCFSEGDKVNYERFRNWLLQNKEAFTLSRWLLSGGVCVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFVPLVSPPIHASLSEGLFHAF
DENRDNHIDFKEISCGLSACCRGPVAERQKFCFKVFDVDRDGVLSRDELHEMVVALLEVW
KDNRTDTLPELHSSVSDIVEGILKMHDTTKLGHLTLEDYQIWSVKSALANEFLNLLFQVC
HIVLGLRPGSPEEEGQIIRGWLERESRHGLQQSQNWFPISMLWWQQWKDYVKYEHKGIVV
EQPSILSSLRTPMSTATIEPAPPDRLGGLGTFSSVSPTEERSPDAVSSASEATETGQSAH
VASSATDGCFARQHNVSDNNNQCFSGANGHLPSQLAAQRPGAIDNQPLVNTDPMKAPTLT
MEGGRLKRSLQLVPGRDFETVPEPVWRALYHWYGANLSLPRPVILESKTGQAELELFPRY
LLFLRQQPATRSPQSNIWVNMAGSVPSPNAPLKRALAYTGCFSRMATIKDIHLYLSQRLR
IKEEDMRLWLYNSENYLALLDDEDHTLESLKIYDEQQLVIEVRNKDMSWPEEMSFIANSS
KMDRHKVPVPTEKGATGLSNLGNTCFMNSSIQCVSNTKPLTEYFSSGRHLYELNRTNPIG
MRGHMAKCYGDLVMELWSGTQKNIAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLH
EDLNRVHEKPYVELKDSDGRPDGEVASEAWENHLRRNRSIVVDLFHGQLKSQVKCKTCGH
ISARFDPFNFLSLPLPMDSSMHLEITVIKLDGSTPVRYGLRLNMDEKYTGLKKQLSELCG
LKPEQILLAEVHTANIKNFPQDNHKVRQSVNGFLCAFEIPVPGSPTSLSSPTPSDIPPIA
NGSAAKENLGSELALIPNGGPSTLVPRSPETPVANGVANGHITPMQESPFTGYIIAMHRK
MMRTELYFLSSQKNRPSLFGMPLIVPCTVHTSKKDLYDAVWIQVSRLASPLPPQEASNHA
QDCDDSMGYQYPFTLRVVGKDGNSCAWCPWYRFCRGCTIECSEDRASVGNAYIAVDWDPT
ALHLRYQTSQERIVEEHCSVEQSRRAQAEPISLDSCLKAFTSEEELGEDELYYCSKCKTH
RLATKKLDLWRLPPMLIVHLKRFQFVNGRWIKSQKIVKFQRENFDPSAFLAPRDLEQRCL
HSCSESEDLLREIKHKGAKQLTPWQRECLQHMSFPTVSPASTRKSSPSLSRTSSPSGSPK
SGNGGRRPARLRLPQLGSRHRLSNSKENLEAAADAEAEPSDDTEGSEAPGSGGASASEAL
CGSEASSSHCDVVLVNGDSNGLNSDGSTESSMEPDHPPLQHRDSVCLDAIYNLYAISCHS
GIMGGGHYVTYAKNPNGKWYCYNDSSCKEVRPEEIDADSAYILFYEQQGVDYSQFLPKTD
GKKMADTSSMDEDFESDYKKYCVLQ
Download sequence
Identical sequences G3PJX4
69293.ENSGACP00000017904 ENSGACP00000017904 ENSGACP00000017904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]