SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017975 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017975
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.04e-25
Family Ubiquitin-related 0.00000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017975   Gene: ENSGACG00000013591   Transcript: ENSGACT00000018010
Sequence length 119
Comment pep:known_by_projection group:BROADS1:groupXI:13330361:13333371:-1 gene:ENSGACG00000013591 transcript:ENSGACT00000018010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEEQRLYKDEVMLNDCQTLGNC
GFTNQTARPQAPATVGLAFRLSDDSFEQLRVESFSTPPELPDVMKPQDSGSTANEQAVQ
Download sequence
Identical sequences G3PK45
69293.ENSGACP00000017975 ENSGACP00000017975 ENSGACP00000017975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]