SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017977 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017977
Domain Number 1 Region: 132-262
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-42
Family UAS domain 0.000000387
Further Details:      
 
Domain Number 2 Region: 448-530
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-23
Family UBX domain 0.0000258
Further Details:      
 
Domain Number 3 Region: 12-51
Classification Level Classification E-value
Superfamily UBA-like 0.000000689
Family UBA domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017977   Gene: ENSGACG00000013594   Transcript: ENSGACT00000018012
Sequence length 531
Comment pep:known_by_projection group:BROADS1:groupIII:1616717:1623145:-1 gene:ENSGACG00000013594 transcript:ENSGACT00000018012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGDTSAPEVNGLIQQFTAITGATESVGQHMLEACNNNLEMAVTMFLDGGAIAEEPST
SSSSAASSSRAPPSDDVRAPIPQKQDILVEPEPLFGVPKRRRPARSIFDGFRDFQTETIR
QEQELRNGGTVDKKLSTLADLFRPPIELMHKGSFETAKDCGQLENKWLMINIQNVQDFAC
QCLNRDVWSNDAVKTIIREHFIFWQVYHDSEEGQRYIQFYKLNKFPYISILDPRTGQKMV
EWNQLDVASFLEQTTGFLAEHGQLDGPSCHAPPAKRARSESLIDASEDSQLEAAIRASLQ
ETHYESSNAPEEPDSPPSEDEESDAEPFSDSEGPISVDGSDSEMPAPHDEKSFPSKHASL
PAANAAQQRLHPDSSTSSHRKSPYKENNHSHKKEESKKNHLEPSAGGPRHPQPDAESGGN
HCPSVAESAGPSKTSATKTCDVDCPDDNGTIGPKARLMLRYPDGQREQISLSSKAKLLAL
VRHVQFKGYPNERFELVTNFPRRKLAHLDYDITLQEAGLCPQETVFVQERN
Download sequence
Identical sequences G3PK47
ENSGACP00000017977 69293.ENSGACP00000017977 ENSGACP00000017977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]