SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018021 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018021
Domain Number 1 Region: 11-123
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-26
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018021   Gene: ENSGACG00000013634   Transcript: ENSGACT00000018056
Sequence length 244
Comment pep:known_by_projection group:BROADS1:groupXI:13361290:13364230:1 gene:ENSGACG00000013634 transcript:ENSGACT00000018056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLHEKILTHYLSCTSPVDKEGYLYKKKERNATYRRRWFVLKANLLFYQERPGDRHLLGV
IVLEGCSVRRSESDVEFAFSLVFEGPGLKTYRFAARDGQTQESWVQTLVSASHCYLSLLV
GDLGRQYEDNQGNICRLRLTPFVTRFPLLQKPNSNRAPEGPVPRAPGPNSPPATSPSPRR
GRPPRSDRGGASVPARFYKPRRCPPRRWLKSPLSPLEDFGKLHDHYGQEVKRAREEWLRS
RRAR
Download sequence
Identical sequences G3PK91
69293.ENSGACP00000018021 ENSGACP00000018021 ENSGACP00000018021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]