SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018029 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018029
Domain Number 1 Region: 42-97
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000344
Family CUE domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018029   Gene: ENSGACG00000013641   Transcript: ENSGACT00000018064
Sequence length 351
Comment pep:known_by_projection group:BROADS1:groupI:19560309:19573199:1 gene:ENSGACG00000013641 transcript:ENSGACT00000018064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFKRSSSNGGSESSGSGGGGGGRGGGGGQGQLNNSRTNRQVRRLEFNQAMEDFKTMF
PSMDYEVIECVLRSNNGAVDATIDQLLQMSIDGQGSDDSSDSDDSIPPEILERTLEPDSS
DEEPPPVYSPPSYDMHIYDRKYPEAPPSPPPRFEAQPPPGHQQVRSYRNWNPPLLGNLPD
DFLRILPQQLESIKSGAGTSGSPGLTMGATEQDKKLKQYLEDERIALFLQNEEFMRELQR
NREFLVALERDRLKYESKKSKSTHSSIGLGLCAGEQYSAASLEAVSDDAMFRDKLKHMGK
STRKKLFEIARTFSEKTKRRKSKRKMLLKHHSLGTTNSTSNLLDDVEANPC
Download sequence
Identical sequences G3PK99
ENSGACP00000018029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]