SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018035 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018035
Domain Number 1 Region: 14-69
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000357
Family CUE domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018035   Gene: ENSGACG00000013641   Transcript: ENSGACT00000018070
Sequence length 354
Comment pep:known_by_projection group:BROADS1:groupI:19564481:19576350:1 gene:ENSGACG00000013641 transcript:ENSGACT00000018070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFKLNNSRTNRQVRRLEFNQAMEDFKTMFPSMDYEVIECVLRSNNGAVDATIDQLLQ
MSIDGQGSDDSSDSDDSIPPEILERTLEPDSSDEEPPPVYSPPSYDMHIYDRKYPEAPPS
PPPRFEAQPPPGHQQVRSYRNWNPPLLGNLPDDFLRILPQQLESIKVKNSGPQNWHKDRR
LKDNLSLSQDKKLKQYLEDERIALFLQNEEFMRELQRNREFLVALERDRLKYESKKSKST
HSSSMENSTGRYHSLSFLCQASLEAVSDDAMFRDKLKHMGKSTRKKLFEIARTFSEKTKR
RKSKRKMLLKHHSLGTTNSTSNLLDDVEANPCEENGQSRRANPQEENERHEPML
Download sequence
Identical sequences G3PKA5
ENSGACP00000018029 ENSGACP00000018035 69293.ENSGACP00000018035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]