SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018075 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018075
Domain Number 1 Region: 146-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-45
Family Galectin (animal S-lectin) 0.0001
Further Details:      
 
Domain Number 2 Region: 9-144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.02e-43
Family Galectin (animal S-lectin) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018075   Gene: ENSGACG00000013667   Transcript: ENSGACT00000018110
Sequence length 277
Comment pep:known_by_projection group:BROADS1:groupI:19633520:19638360:1 gene:ENSGACG00000013667 transcript:ENSGACT00000018110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIAEIRSIIIPFTGSIHGGLQEGKSISISGRVMPRADRFHVNLQCGSGPKADIALHLNPR
YDTTPGYVVTNSFQAGSWGSEERKPNSPFPAGCTFSLSITLSRDSYQLNINGSHFMEYRH
RIPFHRVDTIVVAGKVEISSIAFQIPMAVPYKSPIGGGLTSGRTITIKGKVLPNATRFSV
NLSYPSGIALHYNPRLDENVVVRNTKQGEQWGPEERGGGMPFHRGKPFLLTIGCEKQSFR
ILNNGMLAHDFKHRFTHLQRIDTLEINGDVSLTSVQL
Download sequence
Identical sequences G3PKE5
ENSGACP00000018075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]