SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018110 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018110
Domain Number 1 Region: 49-397
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-75
Family Protein kinases, catalytic subunit 0.00000247
Further Details:      
 
Domain Number 2 Region: 1002-1063
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000121
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0046
Further Details:      
 
Domain Number 3 Region: 1082-1197
Classification Level Classification E-value
Superfamily PH domain-like 0.000000129
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Domain Number 4 Region: 1231-1512
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000051
Family Tricorn protease domain 2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018110
Domain Number - Region: 547-657
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.0078
Further Details:      
 
Domain Number - Region: 749-840
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0497
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018110   Gene: ENSGACG00000013698   Transcript: ENSGACT00000018145
Sequence length 1691
Comment pep:known_by_projection group:BROADS1:groupXVIII:16088024:16107362:-1 gene:ENSGACG00000013698 transcript:ENSGACT00000018145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQARLKRLEELLLEQKAAGCLSVEALLDLLLCFYTEVSHSPLKREKHVTDFLEWVKPF
TTTVKDMRLHRDDFEMLKVIGRGAFGEVAVVKMKHTERVYAMKILNKWEMLKRAETACFR
EERDVLVKGDSQWITTLHYAFQDDNYLYLVMDYYVGGDLLTLLSKFEDRLPEDMSKFYVA
EMVLAVHSIHQQRYIHRDIKPDNVLLDVNGHIRLADFGSCLRMMEDGTVQSSVAVGTPDY
ISPEILQAMEDGMGRYGPECDWWSLGVCVYEMLYGETPFYAESLVETYGKIMNHENTFQF
PSHGTDVSRGRQDLTQRLPGPGELLGLNGISDFKSHAFFSGIDWENIRSAEAPYIPDVSS
PTDTSNFDVDDDVLKNPEISPPMSHSGFTGQHLPFVGFTYTTDSCFADRSSVRQTGLGQE
EAGAGGGGQEVEAFERRIRRLEQEKQELNRKLQGETCSTQALQAPPRGGTLTRDKEIKKL
NEEIERLKKKLADSDRLEHQLEEAVTLRQDYESSASKLKSLERQVKTLRQEKEEVHKQLA
DSLERLRSHGKELKEAHAQRKVALQEFSDLSERMVDLRSSKQRLSRQLRDKEEEMDTLLQ
KMDAMRQEIRKTEKNRKELEGQLDDAKAEAQKEKKLREHIEVHSKQLETELQNLKAQQGR
GAVAGGADFQQELSRMKADLDTKSLFYEEELLRRDSSHSSEIKKLRKDLQESEGAQLTAN
KELLQLREKLDKAKRDRQAEMDEAVSVVKEKSEREKNLLTEENRKLTAETDKLCSFVDQL
TAQNRQLEDDLQDLSSKKESVAHWEAQIAEIIQWVSDEKDARGYLQALATKMTEELETLR
SSSLGPRTLVTTSVTHTHTGNMHTHTHTHTLIRAKQMVQEELRKVKAANINMESKLKESE
ERSREMGEQVESLKKEMEDSRSRSDKGLKLPDFQDSIFEYFNTSPLAPDLTFRVSHLSTT
DIDSTPLKSEATPPSPSTTSEQEEVKAASVPASPSPTYQSSALTTPKPKAHQLSIKTFSS
PTQCTHCTSLMVGLLRQGYACEVCSFICHVSCKDHAPLVCPIPAEHTKRPQGIDVQRGIG
TAYKGYVRIPKPSGVKKGWQRAFALVSDCKLFLYDVPEGKSTQPGVGASLVLDLRDEEFS
VSSVLASDVIHATRKDIPCIFRVSSSQLISQLSAVSLLVLAESEVEKRKWVRILEGLQGI
LTKNLLKNQQVHILHEAYDASLPLIKTALSAAVLDRERIALGTEDGLFVVEVTRDVIVRA
ADSKKIHQIDLIPKEKIVALLCGRNRHVHLHHWGALEGAESAFDLKLTDTKGCQALTTGV
LRPGGPSCLLAAVKRQVLCYEISRVKPYHKKLWEVQAPGGVQWLGMVRDRLCVGYPSGFA
LLALQGESSPISLVNPADPSLAFLAQQSLDALHALQVGPTELLLCFSQLGVYVDGQGRRS
RTQELMWPATPLACSSNSTHLTVYSENGLDVFDIHTTEWVQTISLRKIRPLNIEGTLNLL
SSEPPRLIYFSNTSSERDLTIPETSDQSRKLMVRTRSKRKFLFKVPEEERLQQRREMLRD
PELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSVMPSSQDDPVKDKPRPLSSISRQQR
SKTHITRTASDFGGGASSRSVSELDPDLDREPDSDSTKHSTPSNSSNPSSPPSPNSPHRS
QLTLDGLEMDP
Download sequence
Identical sequences G3PKI0
69293.ENSGACP00000018110 ENSGACP00000018117 ENSGACP00000018110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]