SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018113 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018113
Domain Number 1 Region: 827-1108
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.26e-70
Family Protein kinases, catalytic subunit 0.00000816
Further Details:      
 
Domain Number 2 Region: 521-817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.43e-48
Family Protein kinases, catalytic subunit 0.00006
Further Details:      
 
Domain Number 3 Region: 360-475
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-20
Family SH2 domain 0.0018
Further Details:      
 
Domain Number 4 Region: 267-375
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-16
Family Third domain of FERM 0.014
Further Details:      
 
Domain Number 5 Region: 140-260
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000837
Family Second domain of FERM 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018113   Gene: ENSGACG00000013704   Transcript: ENSGACT00000018148
Sequence length 1121
Comment pep:known_by_projection group:BROADS1:groupXIII:17233563:17244198:1 gene:ENSGACG00000013704 transcript:ENSGACT00000018148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLPVMDAVTDACPPLHRNGTAHREPPVAAAAATVLRLHFYHGGQGAAECGFLAYPPGD
YVAEELCIDAAAACSISPLYCNVFALYRERDSLWFSPNHIFQVDEVASEDVFFRIRYYFP
GWYSGGSSRAYRYGVSKGSESPVLDDFVMSYLFSQWRNDFINGRVKVPNSHETQEECLGM
AVLDMTRTAKERQMSPLDIYHTTSYKSFLPKDMSAQIKDCNFLTRKRIRFRFKRFIQQFS
QCRTTVRDLKLKYLISMESLEKSFYTETFQVREPSSGQLVILVAADFGIQWCREKLKDSD
QELQTLCDFPDVTDISIKQASKEGAVESRVVTINKQDGKNLELEFLSLPEALSFVSLIDG
YYRLTTDAHHYLCKEVAPPRVVEAIASHCHGPISMESAVNRLQKCGNKQGSFILRCSPKD
FNKYFLTFPVEAYDALEYKHCQITRSASGEFNLSGTKRTFSSLQELLSCYQKETVRSDRC
IFQFSKCCPPKPKAEKSSLLVCRNNKGSEVPLSPTLHRHNINQMVFHKIRKEDLEFMESL
GQGTFTKIFKGVRKELGDYGLVHQTEVVMKVLDQAHRNYSESFFEAASMMSQLSHKHLVL
NYGVCVCGEENIMVQEYVKFGTLDTYLKKNRNLINILWKLEVAKQLAWAMNFLEEKQLVH
GNVCGKNVLLIREEDRRAGNPPFIKLSDPGIGITVLPKEILIERVPWISPECVEDPANLS
LAADKWSFGATLWEICSGGERPLASLDNSKKTLFYEDHHQLPAPKWTELANLITSCMDYE
PSFRPTFRAVIRDLHSLFTPDYELIVDSDILPNRTVVSSWSTGGFESQEPAQFEERHLIF
LQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTAEHIRDFEREIEILKSLQHENIV
KYKGVCYSAGRRNLRLVMEYLPFGSLRDHLMKNKERIDHKMLVHFTSQICKGMEYLASKR
YIHRDLATRNVLVESELRVKIGDFGLTKVLPQDKEYYMVKEPGESPIFWYAPESLTESKF
SVASDVWSFGVVLYELFTHSDKTSSPPAVFMSMMGNDKQGQLIVYHLIELLKSGSRLPQP
LGSPAEIHEIMEECWDNDPGLRPSFKELSLRIDLFRDSREF
Download sequence
Identical sequences G3PKI3
69293.ENSGACP00000018113 ENSGACP00000018113 ENSGACP00000018113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]