SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018122 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018122
Domain Number 1 Region: 5-365
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.63e-128
Family Motor proteins 0.0000000000174
Further Details:      
 
Domain Number 2 Region: 504-609
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.35e-28
Family FHA domain 0.0000114
Further Details:      
 
Domain Number 3 Region: 1567-1664
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-24
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018122   Gene: ENSGACG00000013708   Transcript: ENSGACT00000018157
Sequence length 1685
Comment pep:known_by_projection group:BROADS1:groupIII:1661866:1678091:1 gene:ENSGACG00000013708 transcript:ENSGACT00000018157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVASVKVAVRVRPFNSREIGKDSKCIIQMSGNTTTILNPKQPKENKSFNFDYSYWSHTT
PEDLSFASQKQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEQDQQGIIPL
LCEDLFTKIHGTNTDNNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLMGPYVED
LSKLAVTSFNDIQDLMESGNKARTVAATNMNETSSRSHAVFNIIFTQKKHDMDSENTSEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEQDSVPNKNKKKKK
VENFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAV
INEDPNNRLVRELKEEVARLRDLLFSQGLGDIIETYHCNGPVIAGLKLSNAMTGMSPSPS
LSALSSRVGSINNLHDRIFSPASEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREA
LLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGLTKVGREDAKSRQ
DIVLSGHFIRDEHCTFSSTTGPLGEECVILEPCEGSETYVNGKRVSSPTVLRSGNRIIMG
KSHVFRFNDPEQARLERERTPCAETPVEPVDWAFAQRELLEKQGIDMKQEMEQRLQELED
QYRKEREEASNLLEQQRLDYESKLEALQKQVDYFLFDQSCHASSVSPPPVPWTPRETELA
LWAFRKWRFYQFTSLRDLLWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLL
PPSVAKERERRPFPQTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAELPSSGV
EDCDHALSGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAV
QAISADEEAPDYGSGVRQSGTAKISFEDKQFEKFQTESCPGGLSHSNTSQEELRFVEGEG
QNTEIGISADEVNNNCPGDVHPSDVRGPPARPGLDLPLDLSPEKALSHLKIGSTFTFRVT
VLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNITVEVTKSFVE
YIKTQPIVFEVFGHYQKQPFPPLCKDLISPLRPSRRQFPRVMPLSKPVPATKLSTLTRST
AGPCHAKYDLMAFFEICELEANGDYIPAVVDHRGGMPCHGTFLLHQGIQRRITVTIAHET
GNDIEWKEVKELVIGRIRNTPEADETIIDPNILSLNLLSSGYFWPKHNDKTFYRFEAAWD
SSMHNSLLLNRVTPYGEKIYITLSAYLEMENCTQPTVITKDFCMVFYSRDAKLPASRSIR
NLFSTGCLRPSESNRVTGVYEVTLCHVADNGSPGMQRRRRRVLDTSVAYVRGEENLAGWR
PRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLEATLLAGQDALYKGSDISDFAKSP
VLGHSPGSSPAFDSPNQRQRELAAKCLRLLMHTFNREYSQVSSSASESKLSEMSASLMSD
SSSGLSTLTPSSTCPSLVEGNYDIRSYRHTEPSSGASTPDLDPYSPVDRKKALRGCTFVP
DIQEIRVSPIVSKKGYLHFLEPHTSGWVKRFVVVRRPYVYLYRSERDSVERAVINLSSAK
VEYSEDKQTLLRTPNTFAVCTEHRGILLQATNDKEMHDWLYAFNPLLAGTIRSKLSRRKS
VQSVP
Download sequence
Identical sequences G3PKJ2
ENSGACP00000018122 ENSGACP00000018122 69293.ENSGACP00000018122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]