SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018243 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018243
Domain Number 1 Region: 867-1146
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-68
Family Protein kinases, catalytic subunit 0.00000789
Further Details:      
 
Domain Number 2 Region: 565-863
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.63e-42
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 3 Region: 418-522
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000148
Family SH2 domain 0.0075
Further Details:      
 
Domain Number 4 Region: 357-423
Classification Level Classification E-value
Superfamily PH domain-like 0.0000197
Family Third domain of FERM 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018243   Gene: ENSGACG00000013787   Transcript: ENSGACT00000018278
Sequence length 1165
Comment pep:known_by_projection group:BROADS1:groupXI:13507254:13515971:1 gene:ENSGACG00000013787 transcript:ENSGACT00000018278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCYFHIGIRGRSKSSRSGAPAALREPPQAAGIHVYLFWSKEGERYLSHSAGRVTAEDLCI
CAAEAAGITPLCHTLFALYNPHSRCWYSPNHEFSPDDSNLVLHFRMRFYFRNWHGLNEKE
PTVSRYAHRSGQGGSPLFEITSLEYLFFQAKYEFVNEMVQMEDVQSEEEGSRLKNESLGM
AVLQLSHQAMLTGCTLQDAADKVSFLHCIPRSFAKQISKDNFLTKLRIRRVFREFVRTFQ
QHTVDKGRLGAQEIMYRYIATLEHLAPRFGSETFPVSQLELRDDGIESSSYSNSTRYEGA
PEDDFIGPATHEVLVSGTKGVRWRPVSEQKAQANTYLRNDYMKTKKQPSSQPSENTTDKW
TSFCDFREITHIAITGTNVCISTLDNRCLEVQMNSSQEARSFISLLDGYNRLTAFAHHYL
CHEVAPPRVVLSVANGLHGPMHDDFVLLKLRREAAEEGAFLVRWSALDYRGIILAVLNKN
ENGTKPGHKQFRIQLKGPKFCLEGWDREFSSVKELAESLKTFVLKSGSDSFTVRKCCLPK
HAELSNLVVVRQGVPTEHLTLNTTQLRFHQIKERDIVQKQHLGRGTRTHIFSGHLLVQGG
GENDQDDEFNNNSGGRKEIQVVLKILDQSDKDIDLGFLETASLMSQVSHNHLVFVHGVSV
KGSENIMVEEFVEFGPLDVFLRKEKGSVNSQWKFIVAKQLASALNYLETKRLVHGNVCAK
NILVARRGLESGTSPFVKLSDPGVSLSVLSREERLERIPWIAPECVDTGSHAANAADQWS
FGVTLLEICYDGDLPMSGGTLSEKERFYQQKGRLAEPLSPELAKFFSMCLTYEPLERPSF
RTVLRELTGLIIINPNISPSEALPDTDPSVFHKRYLKMMRHLGEGHFGKVTLYLYDPAND
GTGERVAVKALKQDNSQVLEGWKKEIEILKSLYHSNIVKYKGCCTELGGQAVQLIMEYLP
LGSLRDYLPKRKLGVAQCLLFAQQICQGMVYLQSKRYVHRDLAARNVLVENDSLVKIGDF
GLTKHIPEGEIYYRVREDGESPVYWYAIECLKENKFSFSSDIWSFGVTLYEILTRCETRL
SPPNVCFDKMKEIKEEKNVMVLIKLLDTQWRLPRPKGCPHEVGMLMEQCWAAEPAKRPSF
GSLIEMFEAIRQTYNWQPHMNFSLA
Download sequence
Identical sequences G3PKW3
69293.ENSGACP00000018243 ENSGACP00000018243 ENSGACP00000018243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]