SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018282 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018282
Domain Number 1 Region: 549-673
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-19
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 85-301
Classification Level Classification E-value
Superfamily ARM repeat 0.00000062
Family HspBP1 domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018282   Gene: ENSGACG00000013830   Transcript: ENSGACT00000018317
Sequence length 727
Comment pep:known_by_projection group:BROADS1:groupXIX:19536249:19549862:1 gene:ENSGACG00000013830 transcript:ENSGACT00000018317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQKDIVKIAIQMPGAYPQLIQLDQKKPLSAVIKEVCDGWNLPGPDNYALQYADGVQTY
ITESNRLDIKNGCILRLTKAPGRCAEDLYKGIQSSDSGVRCDSLKELAKVSTDVTFAQEF
ISRDGHLLLVKIVEDANDNPKALHISLYVCLSFRSNVIMTHTLSGFMELMDHGIVSWENL
SSVFIKKIASFVNAKLTDASIQQVSLDILESMVLSSHSLFLEVKQEITMERLIAHLQVTN
QQIQTKAMALLMALLQTAGDTERQDILAFLNKKNLRQYIHKNIIHSSGSVQDKMAHYLYV
LQSVTLNHMEARMRTPMDCYSQEQRDILHNLRLAAFETETENSLNHERRRSLCAKEFKKL
GFSNNSNPGQDLVRTPPGLLALDTMCYFAARYTDAYSRFVLENSSREDKHECPFGRSSIQ
LTLILCEILRIGEPPSETGSDYHPVFFSQDRLMEELFCVCIQLINKTWKEMRATQEDFDK
VMQVVREQITRTLSSKPTSLELFKNKVNALNYSEILKLRQTERLHQEETLALPVVELKER
LKPELLELIRQQRLNRLCQGTMFRKISSRRRQDKLWYCRLSPNHKMLHYGDAEEDTDSPT
IEALQKKIPVADIKGLLTGKDCPHMKEHKGKQNKEILDLAFSITYDVEEDSLNFIAPSRT
DFCLWTDGLSVLLGRDMTSESMRSELEILLSMEIKLRLLDLENVTIPESAPAVPKPPSNY
NFCYDFS
Download sequence
Identical sequences G3PL02
69293.ENSGACP00000018282 ENSGACP00000018282 ENSGACP00000018282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]