SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018463 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018463
Domain Number 1 Region: 168-244
Classification Level Classification E-value
Superfamily UBA-like 2.33e-19
Family UBA domain 0.0015
Further Details:      
 
Domain Number 2 Region: 8-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-16
Family Ubiquitin-related 0.0086
Further Details:      
 
Domain Number 3 Region: 288-339
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000239
Family UBA domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018463   Gene: ENSGACG00000013983   Transcript: ENSGACT00000018499
Sequence length 415
Comment pep:known_by_projection group:BROADS1:groupXIII:17595848:17599575:1 gene:ENSGACG00000013983 transcript:ENSGACT00000018499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVQEEKIFAGKVLKIHICTVDGTEWLEEVTEDTTVEKLKEKCLKHYVHGSLEDPKTLTH
HKLVHAATERVLADTKTVADENLKDKEVLLLMKKRPPPTPPKMAEVSSDEKKKQDNKAPD
KDAILKATGNLSTRHTDRTVTQHNIRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKA
NAMLDEDEEDRVDETALQQLTEMGFPESRAIKALRLNHMSVTQAMEWLIEHVDDPSVDTP
IPGQDSSGAAASGPSASGPSASGPSTSGPSASGPEESVRQDELTEIFKRIRRKREFRPDS
RAVIALMEMGFDEKEVVDALRVNNNQQDAACEWLLGDRKPSPEDLDKGIDTNSPLFQAIL
ENPVVQLGLTNPKTLLAAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
Download sequence
Identical sequences G3PLI2
ENSGACP00000018463 69293.ENSGACP00000018463 ENSGACP00000018463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]