SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018464 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018464
Domain Number 1 Region: 63-159
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.01e-25
Family Ubiquitin-related 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018464   Gene: ENSGACG00000013984   Transcript: ENSGACT00000018500
Sequence length 159
Comment pep:known_by_projection group:BROADS1:groupXI:13720527:13721620:1 gene:ENSGACG00000013984 transcript:ENSGACT00000018500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEEEDNQRRAEEEEEEDEEALPHSEILDIFEEGLARLVQDPLLCDLPIQVTLEEVNSQI
ALEYGQAMTVRVLKADGEIMPIVVVQNATVLDLKKAVRRFMELKQQREGGVKHISWRYVW
RTYQLIFQGEKLEDDKMRLKDYGIRNRDEVTFMKRLRKK
Download sequence
Identical sequences G3PLI3
ENSGACP00000018464 69293.ENSGACP00000018464 ENSGACP00000018464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]