SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018507 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018507
Domain Number 1 Region: 63-260,540-708
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.53e-97
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000167
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018507
Domain Number - Region: 261-313
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.09
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018507   Gene: ENSGACG00000014010   Transcript: ENSGACT00000018543
Sequence length 1268
Comment pep:known_by_projection group:BROADS1:groupXI:13861286:13869600:1 gene:ENSGACG00000014010 transcript:ENSGACT00000018543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVRSVGSFMSRVLRTLTALSTFGSEAPADEDKDDGGFSTFKPGCKDVPMDGGDLAGFLSG
ERVPGVSGLKNHGNTCFMNAVLQCLSNTELFAEYLVLEHHKGDESDEGKPPANGVHLQKK
GPLSRGEVTEQLSGLVRALWTFEYTPQHSRDFKNAVSKNATQFKGNAQHDAQEFLLWLLD
RVHEDLNTVNPNIRPAVKPPIEEDDQSLEGPSPPLSAGSFVQELFQAQYRSSLTCPHCQK
QSNTFDPFLCISLPIPLPHTRPLYVTVVYQGKYSHCMRIGVAAPLNSTVFRLRDAVSRET
KIPTDQFVLTEMYYDGFHRSFCDDDDDLDIIQESDSIFAFETPETFKLENIRTKRGSLLA
NLNHNNLKYGTEISRTSSFMQGAVTPLTASPNKNLGPEKMILLVCNRACSGHQGKRFGLP
FVLYMERTVTWDALQKEILEKMRHLLRPGVYIQVGPFSLRVVGVVGITYLLPQDERPLCH
PTVERAYKSCGQGGPPHVKIVVEWDKETKDYLFGHTEEEYIPDAESVYLHREQHHQPQAC
TLAQCFQLYTKEEQLAPDDAWRCPHCKQLQQGRIKLSLWTLPDVLILHLKRFRQDGDRRV
KMQNMVRFPLMGMDMAPHVVKRSQSSWSLPSHWSPWRRPYGLGRNPDDYLYDLYAVCNHH
GNMHGGHYTAYCKNSIDGQWYCFDDSEVSPVADDDVCQQTAYILFYQRRTVIPSWSANSS
VAGSTSSSLCDHWINRLPGSRPASLASGASSRRTSMASLAESVEFPVERSEDDGGFSIRP
FVRSIQRQSVSSRSSVASPLAFNDSGIKPSWSLSAKLHMRSNSPSRFSLDSRCSPPLERI
GEACDDKVSTSCFGSYSKHERYFGSRTPLSMMEGNFGDQDNGTRFLDMMYCRAPTPVEKK
GAKSEATENNNQITAIDQNVVPAQAAPCKEPKRKSSTGGLLASKAENSGSSKSCSKAEQE
KTSKKRLCSAHKSCAAETSYGSPVKGKKESVPKGKTANAKKNTSTPCGTPSKTNKAPPGG
DAAAPRKPLVRSTPQSSASPSPTAKKEPGVPDRSSTGRRRLVERSCSRDSVHASPQADGL
RGSPLSRASLSKSGEGARPERRSVRSSSSSSSVTSLRSPSVSAREAQRGGRSEEKGLSFF
RSALRQRESRRSADLGKSALLGKKASERTGKQSAQANELDGGKAGVAASPLTPAGTRGGG
TKPGTKEASKPPGSLSRTLLNVGKSKSSTSELSLKPSSNGKKPPERTASSRKLSSSTPSP
ARAAKRPQ
Download sequence
Identical sequences G3PLM6
ENSGACP00000018507 69293.ENSGACP00000018507 ENSGACP00000018507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]