SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018526 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018526
Domain Number 1 Region: 59-144
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.98e-21
Family Ubiquitin-related 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018526   Gene: ENSGACG00000014033   Transcript: ENSGACT00000018562
Sequence length 287
Comment pep:known_by_projection group:BROADS1:groupXI:14081591:14086410:1 gene:ENSGACG00000014033 transcript:ENSGACT00000018562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQAGGEEVIMDTEAKQKEAEQLCGDAEGGDAEPTTGTDVGDATTQDSSISNGDDADDG
QEMVDLKIIWNKNKYDLKIPVDNTGAQLKERIHSLTGLPPAMQKVMYKGLLPEDKTLREI
KITNGAKIMVVGSTINDVLAVNTPKEVIQQEVKAEENKKEPLCRQKQHRKVLDKGKPDDI
MASVKGTKERLPTVPLSGMFNKSGGKVRLTFKLEQDQLWIGTKERTEKVPMGSIKNVVTE
PIEGHEDYYMMAFQLGPTEASQYWVYWVPAQFVDAIKDTVLGKWQYF
Download sequence
Identical sequences G3PLP5
69293.ENSGACP00000018526 ENSGACP00000018526 ENSGACP00000018526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]