SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018548 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018548
Domain Number 1 Region: 73-216
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.25e-36
Family Regulator of G-protein signaling, RGS 0.000000341
Further Details:      
 
Domain Number 2 Region: 722-803
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-26
Family DIX domain 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018548   Gene: ENSGACG00000014047   Transcript: ENSGACT00000018584
Sequence length 803
Comment pep:known_by_projection group:BROADS1:groupXI:14117957:14128483:1 gene:ENSGACG00000014047 transcript:ENSGACT00000018584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSTSDSGDYLADLRGSFTEDAPRPPVPGEEGELVRSDGRQYAGPGFSSKCEASVATPRR
PDLDLGYEPEGSASPTPPYVKWAESLHSLLDDQEGIHLFRMFLKQEECGDVLEFWFACSG
FRKLEALEGGSEEKKVKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLHIDPAMF
DQAQTEIQAMMEENTYPLFLKSDIYLEYTRTGGESPKLYSDHSSVSGNGKGPSSYLPTLM
EDEEWRCEQEPEEQPDRDPSPANRLTQKLLTETAPLRVASSRFQDGPEFRLAPCREPIHP
YYVNAGYAVAPAASTNDSEQQSMSSDADTISLTDSSVDGVPPYRYRKRHRREMHDSAKAN
GQVPLPHIPRTDRIPKDIHVEPERFAAELIGRLEAVVRQREAQEQLEERLKRVRLIALVQ
YKDKKVKPEGPLPANHVLPPAAALYNHNPRYADSPFSGAAPRDAHEENPESILDDHVRRV
MKTPGCQSPGAGRLSPKSRSPDGVPGAKGTGLGAPAPPGKHPSRHGLKGDGCHPHHHKHA
HQVNHAGAGKPKEPAEAQGGFPGSAETSHYGSKSRSYADGAGSNPAEHAGFSSKGATQCK
RALKKGEEVRPCDAPAPVDEMEKNQKILLWLMEGQKELVLHKRSPYGSASGSKRPGGHEA
QPWTSVQPSHPFVQDPTMPPNPAPSPLIQLEEVRRRLEEETLKSGTVQPKQRHKATKKQP
CENITVAYYFCEELIPYLTSVRGRLVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEE
VREDDAVLPIFEEKIIGKVEKID
Download sequence
Identical sequences G3PLR7
ENSGACP00000018548 69293.ENSGACP00000018548 ENSGACP00000018548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]