SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018603 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018603
Domain Number 1 Region: 164-309
Classification Level Classification E-value
Superfamily PH domain-like 3.83e-30
Family Phosphotyrosine-binding domain (PTB) 0.0065
Further Details:      
 
Domain Number 2 Region: 97-152
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000971
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018603   Gene: ENSGACG00000014090   Transcript: ENSGACT00000018639
Sequence length 318
Comment pep:known_by_projection group:BROADS1:groupXIX:20079687:20095368:1 gene:ENSGACG00000014090 transcript:ENSGACT00000018639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKDCLHSYNDDSDAETVYQSANEEEDPEYEEVVGRICKQSKVTSTTTSEEEEPDGGRPGA
SRSKKFHNLFSNNSSHYSTTGAGSFGVFSCVLDGVERQQSHRAVYRFVPRHADELYLETD
DPVLMLNQSEDLWCQGYNMRTGDTGIFPAFYAVRVAKDTNQAFALAVQKDGWTDQFLGQF
LGSVQVPIHKGNDMLCAAMQKVVSNRRLAGQTPLACVLEVSVKGVKISVQDQCHSAHRGD
QCFHFFQLKNISFCGCHPQHNKYFGIITKHPDQQRFACHVMMSETTSHPLAVSVGRAFQQ
YYKENIGFSCPTEDIFIE
Download sequence
Identical sequences G3PLX2
69293.ENSGACP00000018603 ENSGACP00000018603 ENSGACP00000018603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]