SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018656 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018656
Domain Number 1 Region: 151-252
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-32
Family Phosphotyrosine-binding domain (PTB) 0.00000564
Further Details:      
 
Domain Number 2 Region: 19-117
Classification Level Classification E-value
Superfamily PH domain-like 9.38e-25
Family Phosphotyrosine-binding domain (PTB) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018656   Gene: ENSGACG00000014133   Transcript: ENSGACT00000018694
Sequence length 1028
Comment pep:known_by_projection group:BROADS1:groupI:20930601:20933953:1 gene:ENSGACG00000014133 transcript:ENSGACT00000018694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPATGGHLLRDGASGVKRCGYLRKQKHGHRRFFVLREPTERGPACLEYYESEKKWRN
KSAARRLITLDSCLCVNKRADAKHKHLIALYTKDEYFAVAADSEQEQESWYAVLTDLIAE
GKVYDSPASTSSLVGFEEASYGLMAPATAAYKEVWQVNLKSKGLGQIKNLTGVYRLCLSS
RTISFVKLNSESAAVSLQLMNIRRCGHSDSFFFIEVGRSAVTGPGEFWMQAEDSVVAQNI
HETILEAMKAMKELSEFRPRSKSQSASTNPISVPTRRNLNNLPPSQTGLVRRSRTESVAA
TSQGRKFTSCRIRTASEGDGSVTRPVSMSISGNTSPSSGNHLIRSNTLSSGRTCRMLDSS
SSLHHSRSMPVSNSPPGTSSPVSMSPRRGGRICTPDKARRPFSCSASISGSLSDTGFMTC
DDYSSSPGELRFIPLTRSDTPDSLCSTPPSRDISDPCGYMIMEETNDGGPEAGGGEGPAN
HAAYRKRTHSLTTPRQQRVVAPLSSASLDEYTLMQMAQGQNSHSASPKVCYPEDYGDVEI
GSSRSSSSNLADDGYMPMTPGVSAESGKTDNYMPMSPMCVSAPKQIVNPRVHPQAAAGGG
FKTSSPSSSLEDSGYMRMWSSADSPDRQGEYMNMSPGNPPPLQTPPDYYVGPLAAEPASK
IEESSQYVLMSPQSLRQRTGESDYYSVMQPSAAQSSPLSPSLPSPVRHGRAENLHYRGRL
GRPNRLSLDTVRTLPSMNEHPLPGEPRSPGEYINIEFARFSVVSAESQSPSAGSTVGGPR
SASLTDYMNLQLGSRSPKKTPAERLGTLPELPVCSGEDGVYRLAGEQGSQARGDEEKSDY
TEMTFGMTSSPAQLVPQNTASCQSGRESRLSLEDQGVPEGIGVFLIGATSSSAVDPDCSA
KVIRANPQGRRRHSSETFSSTATVTPVFPSFARGDAMKRHSSVENISSRSSEGSDEEYGS
PMSRHSSAGYPNRLNYIALNLLDSRDVEKCGELAGFKPSSSCKARINGLHSSPYVCLGFK
EAATTAKG
Download sequence
Identical sequences G3PM25
ENSGACP00000018656 69293.ENSGACP00000018656 ENSGACP00000018656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]