SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018716 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018716
Domain Number 1 Region: 524-810
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-56
Family Protein kinases, catalytic subunit 0.0000136
Further Details:      
 
Domain Number 2 Region: 272-333
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000299
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018716   Gene: ENSGACG00000014173   Transcript: ENSGACT00000018754
Sequence length 821
Comment pep:known_by_projection group:BROADS1:groupXIII:18210034:18254621:-1 gene:ENSGACG00000014173 transcript:ENSGACT00000018754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEVSEQLQKFGANEEECARLNASLSCLRKAHQLVCFPPPPAGSQAKQDWSIQWPTSESG
KENTPVCQPEASQWIRFQLSQSPKVQSKYNQHMCHSPQAPAPPLYAERLTVDSPAAGLFP
PLDFGHRSLPPSPRQRHFGHTPPRTPLVVNTMTPPGTPPMRRRNKVKAPGTPPPPSRKLI
HLLPGFTALHRSKSHEFQLGNRLDDAQTPKAKKKTKPLNLKIHSSVGSCENLPTQRSPLH
SERSLRSFFFPTFIPSTPPVHAETPSANTLSVPRWSPQIPRRDLGNSIKHRFSTKYWMSQ
TCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPPCHLLIIQRGGLARLVRTESVPCDINNPL
RYSDLHISQTLPKTNKINKDHIPAPYQPDSSSNPSSTTSSTPSSPAPPLPSSATPPSPLH
PSPQSARQQKQFNLTASSYFKYKQQFIFPDVAPEAPPSRAPQVILHPVLSEPGSDANPLL
QIEVEPTSDNEECNDEDSGDEFEEMNLSLLSARNFPRKASQTSIFLQEWDIPIEQLEIGE
MIGKGRFGKVFHGRWHGEVAIRLIDIERDNEDQLKAFKREVMAYRNTRHENVVLFMGACM
SPPHLAIITSLCKGRTLYSVVRDAKVVLDVNKTRQIAQEMVKGMGYLHAKGILHKDMKSK
NVFYDNGKIVITDFGLFTISGVLQAGSRREDKLRIPNGWLCHLAPEIIQQLSPDTEEDKL
PFSKQSDVFAFGTVWYELHAREWPYKSQPAEVIIWQIGSGMKPNLSQTGMGKEISDILLL
CWAYQQEERPSFSKLVDLLEKLPKRNRRLSHPGHFWKSAEY
Download sequence
Identical sequences G3PM85
ENSGACP00000018716 ENSGACP00000018716 69293.ENSGACP00000018716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]