SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018734 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018734
Domain Number 1 Region: 2020-2319
Classification Level Classification E-value
Superfamily BEACH domain 1.12e-126
Family BEACH domain 0.0000000109
Further Details:      
 
Domain Number 2 Region: 2440-2715
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.32e-34
Family WD40-repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 1911-1994
Classification Level Classification E-value
Superfamily PH domain-like 1.25e-24
Family PreBEACH PH-like domain 0.0039
Further Details:      
 
Domain Number 4 Region: 612-759
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000416
Family Laminin G-like module 0.056
Further Details:      
 
Domain Number 5 Region: 65-235,280-379,418-434,969-1263
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000816
Family Diap1 N-terninal region-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018734   Gene: ENSGACG00000014174   Transcript: ENSGACT00000018772
Sequence length 2729
Comment pep:known_by_projection group:BROADS1:groupI:21063176:21092565:1 gene:ENSGACG00000014174 transcript:ENSGACT00000018772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLTGTMASKERLYEVWMLYCTKRDPDYLKLWLEVFISSYEQCLDVDFEKPLSRPEEVPPV
LTLLPDNILQVLRHQLLQCVQKASDGLEPEQQNLALLLLKFLIVICRNLSNVEEIGTCSY
INHVITMTTLYIQQLKSRTKEKEMADQSQAEEFVRHALAFCESLYDPYRNWRHRTCGEQL
GTVERSRQKYKAAPLTVEFVPFFYQCFQESEHLKESLKCCLLHLFGAIVAGDQRNAQLAI
SPATMEVLMRVLADCSMGGCSSDEGEDWDSEAPDHKALLTLGCLREVVQRLLASSSDQRQ
VEIASVLENYFKLLNSDPAAVVASQLQHWESRFVALQVNMLDTIRDMFLCSDRPVLQAIF
LNSNCFEHLTRLLQNSKLVNARCTAADKDQKDITNNRLLTGERDTQHYKVLQGRLDSLAV
ATIKALTTVMHKSPAAKEVFKERIGYNHLYEVLTSLGQPSRRLLKELMNMAVEGEHTSVG
LLGISNVEPLLLLAQWLPELDSSERQLFTADWLRRLSCLNRQTRATCVNAAMVMRALAGL
ERHQRLHRACAESLLGLVGSLGSQSLAAGELLGLLRLLRPPESTHVHPYVGPALRALLAM
VRKQGLESAMQYFDLSPSMAGIVVPTVQRWPGSAFSFLAWLSLDQDQLGPPSKDKRKQLY
SFFTPGGTGFEAFISSVGVLVVAVCTKKEYVTVMLPDYCFCDSLWHSIGVVHVPGKRPFG
QSLVYIYVDGQQKLSAPLKYPSMTEPFISCCIGSAGHRTTTPPPSQIPDPPFSSVITPTT
RSSLGAILSPQTWGGLLGGKPESLTKLISAGTQDSEWGSPTSLQGQLGGVMVFHEPLQPN
HMKAICSAGPNCISPFKAQESELGDLSTKLLLHYSPKACRNPICLDLSPNMLHGRLTGNK
VVNWEIKDMINCVGGLPVLFPILEQLTLIIPDQQPSDPAAGSDLITPDVTTPPDGDWVLL
PSNRASEARLEKNLVATFLLVLKHFLQRHPINQDNLLHSHGVGTLGALLQKLPAGHVDVS
VLVAMQLLIEQVTHEKNQVLLQQLHTHLLFNFNIWNKGDFPLRIDEGHIQYMSTVIKDNR
KQFRKKYGVQFLLDTVRLYYGRGSSNKESDLSEDDVRTIRASLCGLIKYYISKGMSQEEM
QSILGYVAAIGPEEQLCGMLELLLSLLQTSPARDQLFLLLFEPGAADSCYALVLNNKYSD
RLRELVFKLFERMLRCDRVYEKNKQRLRLREAGYSGMSLLFSEIHITPTLIRCLLNQVLH
TDHVVNYKDLMALVQLTHRAGPSERLLVCKRVYQLLHSQQDAAIQISKQQCWQDTLVRLY
LRSDGSHPQRSTDTISASSLDLSRGGLESGDVLSLLDTPSSSASSEPQPHVKPWAVGKSG
GLMLDLSHLQPYEVGDGGCQTPGSQASTPSPLETSKPFPGSTGERDATSSLTEDSFLFSD
NLSLGESFNNAEPPERAEEELCHMLLEILLCVMWRGVEGSDDSAWLERGQVFSALAKLAT
ANELLLPVDRIKLSLMERMLEWAVGDNREASAATLPQHTENAVRLLHMVQDFLQAEGLVN
PALWTEKVLEETVTLMDSLMVWYSAGAQWFQLSQVGLRLLLGFMAQEDPEVCALATAKLN
GILQTKQVSSQDEACYLLGKVEGILRRSIQEQREETYCFLVPLLRTLLSKVHRLLFIELH
LPQLPDTNGSPSFFEDFQLYCDSPEWRVYLDKYIIPYMKQYEIETFSQGHETMALYWKEC
YEAFMVSLHKRERERGESKIRFQEQFVEPFSRRGRQENLRYNSMLKQQHSQNSATLRQWK
AARRGLVCERGPWADRQQDEMHWRVSSAENFSRMRLKLVRNYNFDPHREASALRDNLGSV
HQKRVNAESLLLEAAKQVKVSDLEEDILELPEDDPAAANNQIEAEEAGQKEKLVLWEDCE
LVTVVDVVPGRLELTTQHIYFYDSSQEKEEGVGHDFKWPLSQIREVHLRRYNLRRSALEI
FLIDQTNYFLNFKKEVMNLKFQVPVEVRNKVYSRMLLLRSLSLYGTRSPQELLKASGLTQ
KWVNREISNFDYLMQLNTIAGRTYNNLAQYPVFPWILADYTSEELDLSDPRVFRDLSKPV
AVLNERNAKAVREKYESFEDPTGTIDRFHYGTHYSNAAGVMHYLIRVEPFTSLHIQLQSG
RFDCADRQFHSIPATWQTLMDNPNDVKELIPEFFYFPEFLENQNGFDLGRLQISKERVND
VILPKWAKSPEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCTYE
GAVDLDAITDEKERKALEGMISNFGQTPCQLLKEPHPVRLPLEEVEKRKAQLDSCHFSMF
EHLSDLKSFFVEGISDNVPLVKAVVPKNQSHSFITQGSPDTLVTVSQNCLVGTHGWLPYN
KNISNYFTFIKDPTVFNAKTQRFLSGPFAPGVEVTAGLFVASHDGKLLFSGGHWDNSLRV
TSLVKGKTVGQHIRHMDIVTCLSTDHCGIHLISGSKDTTCMVWQVLQQGGAPVGLHPKPV
QVLYGHTDEVVSVSISTELDMAVSGSRDGTVIIHTVRRGHYMRCLRPPCDSSLPLSILHL
AVSWEGHLLVHTCLEGKATLKDKNSLHLYSVNGKHLRSEPLKEQVTDMCVSGEYVVIGSE
EGYLSIRDLYSLSLCAEPMAMRVPVRCVSVTKEQSHVLVGLEDGKLIIVGVGKPAEMRSG
QITRKLWGSSKRMTQISSGETVYNTQHDH
Download sequence
Identical sequences G3PMA3
69293.ENSGACP00000018734 ENSGACP00000018734 ENSGACP00000018734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]