SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018754 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018754
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.98e-30
Family Ubiquitin-related 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018754   Gene: ENSGACG00000014200   Transcript: ENSGACT00000018792
Sequence length 81
Comment pep:known_by_projection group:BROADS1:groupIII:2955186:2956289:1 gene:ENSGACG00000014200 transcript:ENSGACT00000018792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
IQGGSVLHLVLALRGGSRPRR
Download sequence
Identical sequences G3PMC3
ENSGACP00000018754 ENSGACP00000018754 69293.ENSGACP00000018754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]