SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018765 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018765
Domain Number 1 Region: 266-461
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000681
Further Details:      
 
Domain Number 2 Region: 21-152
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-27
Family SH2 domain 0.000000586
Further Details:      
 
Domain Number 3 Region: 200-259
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018765   Gene: ENSGACG00000014203   Transcript: ENSGACT00000018803
Sequence length 461
Comment pep:known_by_projection group:BROADS1:groupI:21140858:21150515:-1 gene:ENSGACG00000014203 transcript:ENSGACT00000018803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNVFDHDEYRPPVWKSYSTVYQLQQEAPHPRRLTCTCEVDNRPKYYGREYHGMISRED
ADQWLSQAEGSYLIRESQRQPGTYTLALRFGNQTRNFRLYHDGKHFVGEKRFESIHDLVT
DGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNQEPTLKKHLPQSPDAPDGPVPPKDDR
QAEERLTALVRRATLRESDLAPKYEKVHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCAD
CGLNVHKQCSKVVPNDCQPDLRHVKKVYSCDLTTLVKAHNTKRPMVVDMCIQEIEARGLQ
SEGLYRISGFSELIEDVKLAFDRDGEKADISSNAYEDLNIIAGALKLYFRELPIPLITYD
AYPHFIETGKIADAEKRLESLHEALKLLPPAHCETLRYLMAHLKRVTEYEKENLMSSENL
GIVFGPTLMRAPGLDAMTALNDIRYQRLVVETLIKNEDVLF
Download sequence
Identical sequences G3PMD4
ENSGACP00000018765 69293.ENSGACP00000018765 ENSGACP00000018765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]