SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018772 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018772
Domain Number 1 Region: 547-759
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-42
Family DBL homology domain (DH-domain) 0.00057
Further Details:      
 
Domain Number 2 Region: 224-368
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-42
Family Third domain of FERM 0.00034
Further Details:      
 
Domain Number 3 Region: 896-1035
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-32
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 4 Region: 123-223
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-26
Family Second domain of FERM 0.00016
Further Details:      
 
Domain Number 5 Region: 745-869
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-25
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 6 Region: 43-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.63e-22
Family First domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018772   Gene: ENSGACG00000014216   Transcript: ENSGACT00000018810
Sequence length 1050
Comment pep:known_by_projection group:BROADS1:groupI:21155272:21181322:1 gene:ENSGACG00000014216 transcript:ENSGACT00000018810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEPADRPSTAGHRLGAADSFGVSTLEPGLRPPAQPAGRQVSIRVQMLDDTQEVFQISQR
SVGKVLFDLVCVHLNLAEGDYFGLEYQDHRKMTVWLDLLKPTLKQIRRPKNTILRFVVKF
FPPDHTQLLEELTRYLFALQIKRDLACGRLVCNDTSAALLVSHIIQSEIGDFDETQSWQH
LLHNKYLPDQDAIRDKITDCHRQHVGQTPAESDYQLLEIARRLEMYGVRLHPAKDREGSN
LSLSVAHVGVLVFQGHTKINAFNWSKVRKLSFKRKKFLIKLRADPASAHHDTLEFAMASR
DCCKVFWKICVEYHAFFRLFEEPKPKPKPILFTRGSSFRFSGRTQKQVIDYVKDSELKKL
PFERKHSKILSHSGLSPHSSSFRSQVPKEQADRLDSVRPGHRGECNGPEEAPSATSGLRD
AVAAAPGSDPIPSRQSHRGTGSSPDPQFLNPVNAREREKPSPRRTEKHPQPHHPKSSSLT
SKSPGSEDSPVGSHRVVVNGNGALNGVPGPCPEGHHLSPLTSPLLTDAGCVRNDDEDEAR
RKKFPTDKAYFIAKELLTTERTYLKDLQVITESFHGVAVKDEAFPDSATSLISTSYDPVH
EFHQGFLREVEQRLAQWEGRSNAHIKGDYQRIGDILLKNIQGLRQLTVHLQKHSECLVEL
ERVCRSSRKAEAACRDFEQQRVCYLPLNIFLLRPLHRLLHYKLLLERLCKHYPPTHEDFR
DCRAALADISEMVLQLQGTMMKMENFQKLLELKKDLTGIDNLAIPGREFIRLGCLSKLSG
KGLQQRMFFLFSDSLVYTSRGMTPSNQFKVHGQLPLYGMTIRESEEEWGVPHSFTLFGQR
QSVVVAASCAAEMERWVEDIRMAIDLAEQSSSPSTDLLPPGLSDNKLTEDGGAELESEDE
LSGSRSSLERPGHRGNTTVHVCWHRNTSVSMVDFSVAVENQLSGNLLRKFKNSNGWQKLW
VVFTNFSLFFYKSHQDDYPLASLPLLGYSVTAPAESENIHKDYVFKLHFKSHVYYFRTES
EYTFERWMEVIRSATCSASRSLSSSRKDLY
Download sequence
Identical sequences G3PME1
ENSGACP00000018772 ENSGACP00000018772 69293.ENSGACP00000018772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]