SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018817 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018817
Domain Number 1 Region: 13-752
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-238
Family Motor proteins 0.000000000794
Further Details:      
 
Domain Number 2 Region: 1662-1748
Classification Level Classification E-value
Superfamily SH3-domain 0.00000289
Family SH3-domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018817
Domain Number - Region: 2106-2218
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000942
Family Second domain of FERM 0.02
Further Details:      
 
Domain Number - Region: 2219-2313
Classification Level Classification E-value
Superfamily PH domain-like 0.00209
Family Third domain of FERM 0.04
Further Details:      
 
Domain Number - Region: 2021-2102
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0176
Family UBX domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018817   Gene: ENSGACG00000014239   Transcript: ENSGACT00000018855
Sequence length 2334
Comment pep:known_by_projection group:BROADS1:groupXI:14654036:14675732:-1 gene:ENSGACG00000014239 transcript:ENSGACT00000018855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSIRILPTMTHREQRDEDGVEDMTQLEEMHEGAVLLNLRKRSERNLIYTYIGSILVSVN
PYKMYNTYGTDMVLLYKGHALGENPPHLFAIADAAYSKMMDAKHNQVIIISGESGSGKTE
ATKLVLRYLAAIHHKYNLVQQIEILEAAPLLESFGNAKTVRNDNSSRFGKYMEVFLEDGV
ISGAITSQYLLEKSRIVFQAKDERNYHIFYEMLAGLPSQQRQAFYLQEAETYYYLNQGGD
CGIPGKNDAEDFLRLIAAMEILHFTPEDQSAIFRVLSSILHLGNVYFQKYESDGQEVASV
VSAQEIRVVAELLQISPEGLQKAVTYKVTETMRDRISTPLSVESAVDARDAVAKILYSLL
FHWLTERINAQVYPRQHSLSISILDIYGFEDLAFEVTPASPFNYSHAHLAMLNITNVFPV
QEEYSREQIPWQNIPFSDNQPCIDLIAAKPHGILRILDDQSCFPQATDHTFLQKCHYHHG
NNPLYQKPKMPLPEMTIKHFAGRVTYQVQKFLDKNYDQVRQDVLDLFIQSKNKMLSNLFQ
SHAEVTGQQRGGRMRKSSTVTRKYQAPTVSNKFQQSLLELVEKMERCNPFFVRCIKPNNM
KQPGVFENDLVSSQLRHSGVLETIRIRREGYPVRMPFYVFLFRYKSLVGMRELPAANGEN
CVIMLSKLCLLRPGAYHVGVTKMFLKEDIYQLLESKRERTRQLAALTLQRYIRMFFVRKR
FVAFRKKIIGLQAHCRGFLTRKRDVKMRESLVRFRSLVHMYVKSVIKHLNLIQELTKREV
VNVTHLVIPAELGVLLQAAGVRRELHSDCLALLQAPHIQEEAQLTLPLDINNYPFYRYVQ
IYFREPKFGMLMAPLESPLTRVEEDLRGEAVELFIMVLRFMGDPHLNGAQENMFGNYIIQ
RGLSSPGLQDEILAQVVNQVWRNVNYDNAERGWLLLLACVCSFAPSTKLEKYLLKFVSDH
APAGCQALLQHRLIQANQKTQLGSGSAPETARTYPLSLLEWTANRKKASMVLQVHCFDGG
SFLCPVHSWTSGEDLAGDVLRHRGVSDWWRGSSVLMKEHGQWVELAAHDYVMDLIADLEL
PPNFPKQKSFFVISTDDPTGVRAKAGLAMFGSGFESDEELPPAFPLRTSGPAHSLPDSDG
YYSHGTQTHTKMSSTLLQASVKSDAFSDGQTQRGMDRYLDSLFDPVLSDGSVDTEKAGGL
SARMKGGGGIGITGGGRGDDESQTPSSRPFPPGIHPGGIALLRSLTIPPSFSFPAHSIKA
VLCKPQQFHQYNLPHHPDRPHNPPTVTPSTRVAPNPPAARAPPAGGDAVASLPAPPSLPV
TPAIPGFPVMTGFPESDFPGPTRGPPPEEVVRSSASNSERIDPSHNIKDIIKHHQPADVT
TSAGPAAPRKGDGNMFGKKPDPHDEAMEILKGKEEGGVKVSKTTTSRPAGPSSLSISPAP
PPVECIGKTWSKISRELPVEEEIIQTQLHSKTSDEYYTYSNVPWKLYMRKEVFYPKETFN
SPLVLDLIFRQVVHDTFSEACIRITEEERQKMKTLFAENKVEQMSGTHDESAKKKVVVMA
RDVWEIYFSRLFPASGSVGTGVQVLSVSHKGIKLLRMVRSSSAASDYFRVLRPYSYSDIL
FVSIPSKNMLEFNLTNEKLILFSAKAPQVKHMIDYFLTELKKDSEYMVAVRNSVTEDRTL
LSFHKGDIIRLQHMDGLEAGKHYGCIVRKKVMLLEELKRDTPEFAGWRFGAVYGKSGVFP
SEYVRPVAAPDFLVLPAERVEPRDRQGRVAASAAIAVAMGSAVAAHELDLSTEAVNEMYG
DGLSVGLDDLPLHGGQYHMTEFAKKYFREAQRNRSDHKAKKAKECREPVDMVKFSKSPIQ
ESLIDFSDSGMNRVAADIFLAIMKFMGDFPLKGQTEQDLVTTILKLSGEHGLIKDEAYCQ
LMKQVTGNTSSKPDSCQRGWRLLYILAAFHRCSDVMKPFVLKFLQDACDSPGMQYQGVAK
ACEQNLRRTFQYGGRIQYPNSMELKAMLAGRSSKRQLFLLPGGIERHLKIKTCSVALDVI
EELCYEMELHRTEALDEYAVFLVTHKGQNVRPLNKREYILDIATEAESVDANYSLWFRRV
IWSLALKLDNELYVTMHYNQVLPDYLKALMSVVPHGKASDPQLQQIARLSALQHRAKDTV
YLPTLREVQECVPPQFYCKQGSQLWLNMTTQHMQQVQPLNPHQARAQFLGLVSAFPKFGS
SFFYIQSCSSASIQAPCILAVNLNGLHFLNKDTHEAIVRFPLKEVQSTRTQRPTSGSSYP
YVEIMIGDLLNQRITQLQLEQGLELCRVIAMHVENMLSVREKRLTLPPSEITML
Download sequence
Identical sequences G3PMI6
69293.ENSGACP00000018817 ENSGACP00000018817 ENSGACP00000018817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]